8h2i/1/5:cl/5:cm

Sequences

>8h2i-a1-m5-ccl (length=55) [Search sequence]

FTSFVLMLLFTGIILIATNELTYNRPREIQYRYLPRDLDSFIRTQEMPSAIFSSM

>8h2i-a1-m5-ccm (length=63) [Search sequence]

TSFVLMLLFTGIILIATNELTYNRPREIQYRYLPRDLDSFIRTQEMPSAIFSSMWDVDTR RGG

Structure information

PDB ID	8h2i (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Near-atomic structure of five-fold averaged PBCV-1 capsid
Assembly ID	1
Resolution	3.8Å
Method of structure determination	ELECTRON MICROSCOPY
Number of inter-chain contacts	65
Sequence identity between the two chains	0.982

Chain information

	Chain 1	Chain 2
Model ID	5	5
Chain ID	cl	cm
UniProt accession	Q84629	Q84629
Species	10506 (Paramecium bursaria Chlorella virus 1)	10506 (Paramecium bursaria Chlorella virus 1)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 8h2i-a1-m5-ccl_8h2i-a1-m5-ccm.pdb.gz

Full biological assembly Download: 8h2i-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

8h2i/1/1:cl/1:cm 8h2i/1/2:cl/2:cm 8h2i/1/3:cl/3:cm 8h2i/1/4:cl/4:cm