8h8h/2/1:B/1:F

Sequences

>8h8h-a2-m1-cB (length=51) [Search sequence]

SRLAEFRAAEKALQEQMAQLEALKKDAGLKREIEFEQKLVGLMKSYDKSLE

>8h8h-a2-m1-cF (length=51) [Search sequence]

SRLAEFRAAEKALQEQMAQLEALKKDAGLKREIEFEQKLVGLMKSYDKSLE

Structure information

PDB ID	8h8h (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the N-terminal domain of H-NS family protein TurB (TurB_nt50)
Assembly ID	2
Resolution	2.7Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	50
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	F
UniProt accession	Q88GF9	Q88GF9
Species	160488 (Pseudomonas putida KT2440)	160488 (Pseudomonas putida KT2440)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 8h8h-a2-m1-cB_8h8h-a2-m1-cF.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 8h8h-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures

8h8h/1/1:G/1:A 8h8h/3/1:C/1:E 8h8h/4/1:H/1:D