8h8r/1/1:H/1:U

Sequences
>8h8r-a1-m1-cH (length=75) [Search sequence]
YQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVS
TWDDRRAEGTFPGKI
>8h8r-a1-m1-cU (length=75) [Search sequence]
YQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVS
TWDDRRAEGTFPGKI
Structure information
PDB ID 8h8r (database links: RCSB PDB PDBe PDBj PDBsum)
Title Bovine Heart Cytochrome c Oxidase in the Calcium-bound Fully Oxidized State
Assembly ID 1
Resolution 1.7Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 20
Sequence identity between the two chains 1.0
PubMed citation 36708913
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID H U
UniProt accession P00429 P00429
Species 9913 (Bos taurus) 9913 (Bos taurus)
Function annotation BioLiP:8h8rH BioLiP:8h8rU
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 8h8r-a1-m1-cH_8h8r-a1-m1-cU.pdb.gz
Full biological assembly
Download: 8h8r-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1occ/1/1:H/1:U 1oco/1/1:H/1:U 1ocr/1/1:H/1:U 1ocz/1/1:H/1:U 1v54/1/1:H/1:U 1v55/1/1:H/1:U 2dyr/1/1:H/1:U 2dys/1/1:H/1:U 2eij/1/1:H/1:U 2eik/1/1:H/1:U 2eil/1/1:H/1:U 2eim/1/1:H/1:U 2ein/1/1:H/1:U 2occ/3/1:H/1:U 5w97/1/1:H/1:h 5wau/1/1:H/1:h 6juw/1/1:H/1:U 6nkn/1/1:H/1:U 6nmf/1/1:H/1:U 6nmp/1/1:H/1:U 7cp5/1/1:H/1:U 7d5w/1/1:H/1:U 7d5x/1/1:H/1:U 7thu/1/1:H/1:U 7tie/1/1:H/1:U 7tih/1/1:H/1:U 7tii/1/1:H/1:U 8h8s/1/1:H/1:U

[Back to Home]