8h9h/1/1:F/1:G

Sequences
>8h9h-a1-m1-cF (length=25) [Search sequence]
KPYLCQQCGAAFAHNYDLKNHMRVH
>8h9h-a1-m1-cG (length=81) [Search sequence]
HMQKCPICEKVIQGAGKLPRHIRTHTGEKPYECNICKVRFTRQDKLKVHMRKHTGEKPYL
CQQCGAAFAHNYDLKNHMRVH
Structure information
PDB ID 8h9h (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of ZBTB7A in complex with GACCC-containing sequence
Assembly ID 1
Resolution 2.2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 10
Sequence identity between the two chains 1.0
PubMed citation 37013936
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID F G
UniProt accession O95365 O95365
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:8h9hG
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 8h9h-a1-m1-cF_8h9h-a1-m1-cG.pdb.gz
Full biological assembly
Download: 8h9h-assembly1.cif.gz

[Back to Home]