8hif/1/1:s3/1:t7

Sequences
>8hif-a1-m1-cs3 (length=98) [Search sequence]
PHWMDPQLMGSQTTQYSRNRGYGDPIRGDLPIVPDDGGWFATRANPAHHLHTGALSMIGG
DASDCGSTAVQQLIKKYEDKGCNNNGLNVMSSHYGGVM
>8hif-a1-m1-ct7 (length=98) [Search sequence]
PHWMDPQLMGSQTTQYSRNRGYGDPIRGDLPIVPDDGGWFATRANPAHHLHTGALSMIGG
DASDCGSTAVQQLIKKYEDKGCNNNGLNVMSSHYGGVM
Structure information
PDB ID 8hif (database links: RCSB PDB PDBe PDBj PDBsum)
Title One asymmetric unit of Singapore grouper iridovirus capsid
Assembly ID 1
Resolution 3.5Å
Method of structure determination ELECTRON MICROSCOPY
Number of inter-chain contacts 133
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID s3 t7
UniProt accession Q5YFM7 Q5YFM7
Species 262968 (Singapore grouper iridovirus) 262968 (Singapore grouper iridovirus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 8hif-a1-m1-cs3_8hif-a1-m1-ct7.pdb.gz
Full biological assembly
Download: 8hif-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 8hif/1/1:s1/1:t3 8hif/1/1:s5/1:t6 8hif/1/1:t1/1:s4 8hif/1/1:t4/1:s6 8hif/1/1:t5/1:s2

[Back to Home]