8ifo/1/1:A/1:B

Sequences

>8ifo-a1-m1-cA (length=76) [Search sequence]

KRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACR FMKCLKVGMLKEGVRL

>8ifo-a1-m1-cB (length=80) [Search sequence]

PKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQAC RFMKCLKVGMLKEGVRLDRV

Structure information

PDB ID	8ifo (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of estrogen related receptor-gamma DNA binding domain complexed with Pla2g12b promoter
Assembly ID	1
Resolution	2.2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	14
Sequence identity between the two chains	1.0
PubMed citation	36944284

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	P62508	P62508
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:8ifoA	BioLiP:8ifoB

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 8ifo-a1-m1-cA_8ifo-a1-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 8ifo-assembly1.cif.gz