8ohs/1/1:C/1:E

Sequences

>8ohs-a1-m1-cC (length=120) [Search sequence]

PPVAVVTAPISLSAAIDVQNKLHKTIGVFLPLSTFITRATEIANQKLPLPANYQPTADEL FNQVLGLDKVTRKESRGSYTPTFGSFVFSLQVPKSEEKRAQAFLQKMKLVLEQEPDKLVR

>8ohs-a1-m1-cE (length=120) [Search sequence]

PPVAVVTAPISLSAAIDVQNKLHKTIGVFLPLSTFITRATEIANQKLPLPANYQPTADEL FNQVLGLDKVTRKESRGSYTPTFGSFVFSLQVPKSEEKRAQAFLQKMKLVLEQEPDKLVR

Structure information

PDB ID	8ohs (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Core-binding domain of fungal E3-binding domain bound to the native pyruvate dehydrogenase E2 core
Assembly ID	1
Resolution	4.1Å
Method of structure determination	ELECTRON MICROSCOPY
Number of inter-chain contacts	17
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	E
UniProt accession	Q7RWS2	Q7RWS2
Species	5141 (Neurospora crassa)	5141 (Neurospora crassa)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 8ohs-a1-m1-cC_8ohs-a1-m1-cE.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 8ohs-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

7r5m/1/1:F/1:J 7r5m/1/1:F/1:M 7r5m/1/1:J/1:M 8ohs/1/1:C/1:H 8ohs/1/1:E/1:H