Alignment result for job MM765589931

**********************************************************************
 * MM-align (Version 20191007): complex structure alignment           *
 * References: S Mukherjee, Y Zhang. Nucl Acids Res 37(11):e83 (2009) *
 * Please email comments and suggestions to yangzhanglab@umich.edu    *
 **********************************************************************

Name of Structure_1: MM765589931A.pdb:A:B:C:D (to be superimposed onto Structure_2)
Name of Structure_2: MM765589931B.pdb:B:A::
Length of Structure_1: 603 residues
Length of Structure_2: 300 residues

Aligned length= 294, RMSD=   0.94, Seq_ID=n_identical/n_aligned= 0.497
TM-score= 0.48192 (if normalized by length of Structure_1, i.e., LN=603, d0=8.59)
TM-score= 0.95995 (if normalized by length of Structure_2, i.e., LN=300, d0=6.36)
(You should use TM-score normalized by length of the reference structure)

(":" denotes residue pairs of d <  5.0 Angstrom, "." denotes other aligned residues)
QNLGAAVAILGGPGTVQGVVRFLQLTPERCLIEGTIDGLEPGLHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHRGDLGNVRADADGRAIFRMEDEQLKVW---DVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGIIARSAGLF*GAAVAILGGPGTVQGVVRFLQLTPERCLIEGTIDGLEPGLHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHRGDLGNVRADADGRAIFRMEDEQLKVW---DVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGIIARSA*GAAVAILGGPGTVQGVVRFLQLTPERCLIEGTIDGLEPGLHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHRGDLGNVRADADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGIIARSA*NLGAAVAILGGPGTVQGVVRFLQLTPERCLIEGTIDGLEPGLHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHRGDLGNVRADADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGIIARSAGLF*
   :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: ::::::::::::::::   :::::::::::::::::::::::::::::::::::::::::::   *:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: ::::::::::::::::   :::::::::::::::::::::::::::::::::::::::::::*                                                                                                                                                    *                                                                                                                                                         *
---VKAVCVLAGSGDVKGVVHFEQQDEGAVSVEGKIEGLTDGLHGFHIHVFGDNTNGCMSAGSHFNPENKNHGAPGDTDRHVGDLGNVTAE-GGVAQFKITDSLISLKGPNSIIGRTAVVHEKADDLGKGGNDESLKTGNAGGRLACGVIGYSP---*VKAVCVLAGSGDVKGVVHFEQQDEGAVSVEGKIEGLTDGLHGFHIHVFGDNTNGCMSAGSHFNPENKNHGAPGDTDRHVGDLGNVTAE-GGVAQFKITDSLISLKGPNSIIGRTAVVHEKADDLGKGGNDESLKTGNAGGRLACGVIGYSP*----------------------------------------------------------------------------------------------------------------------------------------------------*---------------------------------------------------------------------------------------------------------------------------------------------------------*

Total CPU time is  0.76 seconds 

Superposition (Structure_1 in blue and Structure_2 in red)

(water of Structure_1 and Structure_2 in blue and red, respectively; non-water ligand of Structure_1 and Structure_2 in cyan and pink, respectively).

Result download

• Structure_1 (before superposition): MM765589931A.pdb.
• Structure_2 (before superposition): MM765589931B.pdb.
• Structure_1 superposed to Structure_2 (with Structure_2): MM765589931.pdb.
• Structure_1 superposed to Structure_2 (without Structure_2): MM765589931super.pdb.
All the above files will be removed from the server after 2 days.

Reference:

• Srayanta Mukherjee, and Yang Zhang. "MM-align: a quick algorithm for aligning multiple-chain protein complex structures using iterative dynamic programming." Nucleic acids research 37.11 (2009): e83-e83.