MetaGO result for job id PF07587

User Input

>86061773/37-254 (218 residues)
CWVRGNMIASLDGGATDQGKAGGLAGAGDRAVFSLMRHAADVILVGAATVRIENYSGAQL
PVAARQERQRRGQAEVPPIAVVTQSGFLDPNALLFTRTEVPPLILTCRRSFDDTSRRLGS
VAEVIDASAAKSDTVDGATALKIFAERKLYRVLSEGGPLFLGSLIEDDLLDELCLTIAPI
LVGGVARRVVSGPGQVHTTMRRTHVLTDDDGYLYTRYV

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	4xrbA	0.54	5.09	0.296	0.872	Download
2	5xuxA	0.54	5.08	0.144	0.867	Download
3	2d5nD	0.54	4.95	0.153	0.853	Download
4	2p4gA	0.53	5.08	0.112	0.872	Download
5	2aznA	0.51	5.19	0.147	0.826	Download
6	3zpcA2	0.50	4.81	0.120	0.775	Download
7	2g6vB2	0.50	5.04	0.115	0.798	Download
8	2hxvA2	0.49	5.23	0.178	0.798	Download
9	4ha7A	0.49	5.00	0.144	0.757	Download
10	1qzfA	0.45	4.78	0.093	0.693	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0019239	0.24	deaminase activity
GO:0016616	0.23	oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0008703	0.21	5-amino-6-(5-phosphoribosylamino)uracil reductase activity
GO:0050662	0.03	coenzyme binding
GO:0000166	0.03	nucleotide binding
GO:0008835	0.02	diaminohydroxyphosphoribosylaminopyrimidine deaminase activity
GO:0009982	0.01	pseudouridine synthase activity

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:1901360	0.42	organic cyclic compound metabolic process
GO:0046483	0.42	heterocycle metabolic process
GO:0034641	0.41	cellular nitrogen compound metabolic process
GO:0009231	0.12	riboflavin biosynthetic process
GO:0009451	0.11	RNA modification
GO:0055114	0.03	oxidation-reduction process
GO:1901135	0.01	carbohydrate derivative metabolic process
GO:0046443	0.01	FAD metabolic process
GO:0040007	0.01	growth
GO:0031119	0.01	tRNA pseudouridine synthesis

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0005829	0.07	cytosol
GO:0005739	0.01	mitochondrion

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]