StarFunc result for job id A0A024RBG1

User Input

>input (181 residues)
MMKFKPNQTRTYDREGFKKRAACLCFRSEQEDEVLLVSSSRYPDQWIVPGGGMEPEEEPG
GAAVREVYEEAGVKGKLGRLLGIFEQNQDRKHRTYVYVLTVTEILEDWEDSVNIGRKREW
FKVEDAIKVLQCHKPVHAEYLEKLKLGCSPANGNSTVPSLPDNNALFVTAAQTSGLPSSV
R

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024RBG1	1.000	1.000	1.262E-39	181	1.000	1.000	A0A024RBG1.pdb.gz	NUD4B_HUMAN Diphosphoinositol polyphosphate phosphohydrolase NUDT4B OS=Homo sapiens OX=9606 GN=NUDT4B PE=3 SV=1
2	AFDB:P0C027	0.816	0.899	2.468E-32	164	0.801	0.884	P0C027.pdb.gz	NUD10_MOUSE Diphosphoinositol polyphosphate phosphohydrolase 3-alpha OS=Mus musculus OX=10090 GN=Nudt10 PE=1 SV=1
3	AFDB:O95989	0.812	0.854	2.262E-29	172	0.718	0.756	O95989.pdb.gz	NUDT3_HUMAN Diphosphoinositol polyphosphate phosphohydrolase 1 OS=Homo sapiens OX=9606 GN=NUDT3 PE=1 SV=1
4	PDB:2fvvA	0.729	0.974	9.990E-26	135	0.630	0.844	2fvvA.pdb.gz	Crystal structure of human diphosphoinositol phosphatase 1
5	AFDB:Q7JVG2	0.791	0.808	3.051E-25	177	0.508	0.520	Q7JVG2.pdb.gz	Q7JVG2_DROME diphosphoinositol-polyphosphate diphosphatase OS=Drosophila melanogaster OX=7227 GN=Aps PE=1 SV=1
6	PDB:5ltuB	0.693	0.957	6.692E-25	130	0.718	1.000	5ltuB.pdb.gz
7	AFDB:A0A1W2PQS6	0.653	0.410	5.311E-20	291	0.575	0.357	A0A1W2PQS6.pdb.gz	A0A1W2PQS6_HUMAN diphosphoinositol-polyphosphate diphosphatase OS=Homo sapiens OX=9606 GN=RPS10-NUDT3 PE=3 SV=1
8	PDB:7auoA	0.679	0.818	2.617E-13	149	0.227	0.275	7auoA.pdb.gz	Multiple substrate recognition by yeast diadenosine and diphosphoinositol polyphosphate phosphohydrolase through phosphate clamping.
9	PDB:7aukA	0.691	0.742	5.043E-13	168	0.215	0.232	7aukA.pdb.gz	Multiple substrate recognition by yeast diadenosine and diphosphoinositol polyphosphate phosphohydrolase through phosphate clamping.
10	AFDB:Q9LE73	0.663	0.584	5.392E-13	207	0.249	0.217	Q9LE73.pdb.gz	NUDT4_ARATH Nudix hydrolase 4 OS=Arabidopsis thaliana OX=3702 GN=NUDT4 PE=1 SV=1
11	AFDB:Q99321	0.686	0.662	3.857E-12	188	0.221	0.213	Q99321.pdb.gz	DDP1_YEAST Diphosphoinositol polyphosphate phosphohydrolase DDP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DDP1 PE=1 SV=3
12	AFDB:Q52K88	0.617	0.556	1.101E-11	202	0.265	0.238	Q52K88.pdb.gz	NUD13_ARATH Nudix hydrolase 13, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=NUDT13 PE=1 SV=1
13	AFDB:Q09790	0.686	0.596	4.089E-11	210	0.215	0.186	Q09790.pdb.gz	APS1_SCHPO Diphosphoinositol polyphosphate phosphohydrolase aps1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=aps1 PE=1 SV=1
14	PDB:2rrkA	0.526	0.654	1.389E-7	140	0.166	0.214	2rrkA.pdb.gz
15	AFDB:P53370	0.588	0.351	1.694E-7	316	0.188	0.108	P53370.pdb.gz	NUDT6_HUMAN Nucleoside diphosphate-linked moiety X motif 6 OS=Homo sapiens OX=9606 GN=NUDT6 PE=1 SV=2
16	PDB:1vc8A	0.540	0.750	1.928E-7	126	0.193	0.278	1vc8A.pdb.gz	Crystal Structure of Nudix Protein Ndx1 from Thermus thermophilus HB8 in binary complex with diadenosine hexaphosphate
17	PDB:4hfqA	0.529	0.477	5.880E-7	203	0.155	0.138	4hfqA.pdb.gz
18	PDB:4zbpB	0.551	0.384	7.158E-7	270	0.127	0.085	4zbpB.pdb.gz	Crystal Structures of Arabidopsis thaliana Nudix Hydrolase NUDT7 Reveal a Previously Unobserved Conformation.
19	PDB:1ktgA	0.516	0.655	1.133E-6	137	0.166	0.219	1ktgA.pdb.gz	The crystal structure of diadenosine tetraphosphate hydrolase from Caenorhabditis elegans in free and binary complex forms
20	PDB:1mqwA	0.548	0.502	1.473E-6	200	0.122	0.110	1mqwA.pdb.gz	Structure and mechanism of MT-ADPRase, a Nudix hydrolase from Mycobacterium tuberculosis

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A024RBG1	9.08e-136	378	181	1.000	1.000	NUD4B_HUMAN Diphosphoinositol polyphosphate phosphohydrolase NUDT4B OS=Homo sapiens OX=9606 GN=NUDT4B PE=3 SV=1
2	Q9NZJ9	4.13e-133	371	180	0.994	1.000	NUDT4_HUMAN Diphosphoinositol polyphosphate phosphohydrolase 2 OS=Homo sapiens OX=9606 GN=NUDT4 PE=1 SV=2
3	Q8R2U6	7.87e-128	358	179	0.956	0.966	NUDT4_MOUSE Diphosphoinositol polyphosphate phosphohydrolase 2 OS=Mus musculus OX=10090 GN=Nudt4 PE=1 SV=1
4	Q96G61	5.28e-110	312	164	0.823	0.909	NUD11_HUMAN Diphosphoinositol polyphosphate phosphohydrolase 3-beta OS=Homo sapiens OX=9606 GN=NUDT11 PE=1 SV=1
5	Q8NFP7	9.87e-109	309	164	0.818	0.902	NUD10_HUMAN Diphosphoinositol polyphosphate phosphohydrolase 3-alpha OS=Homo sapiens OX=9606 GN=NUDT10 PE=1 SV=1
6	P0C027	3.60e-107	305	164	0.801	0.884	NUD10_MOUSE Diphosphoinositol polyphosphate phosphohydrolase 3-alpha OS=Mus musculus OX=10090 GN=Nudt10 PE=1 SV=1
7	P0C028	3.60e-107	305	164	0.801	0.884	NUD11_MOUSE Diphosphoinositol polyphosphate phosphohydrolase 3-beta OS=Mus musculus OX=10090 GN=Nudt11 PE=1 SV=1
8	O95989	1.19e-88	258	172	0.707	0.744	NUDT3_HUMAN Diphosphoinositol polyphosphate phosphohydrolase 1 OS=Homo sapiens OX=9606 GN=NUDT3 PE=1 SV=1
9	A0A1W2PQS6	1.21e-64	202	291	0.597	0.371	A0A1W2PQS6_HUMAN diphosphoinositol-polyphosphate diphosphatase OS=Homo sapiens OX=9606 GN=RPS10-NUDT3 PE=3 SV=1
10	Q7JVG2	3.59e-62	192	177	0.503	0.514	Q7JVG2_DROME diphosphoinositol-polyphosphate diphosphatase OS=Drosophila melanogaster OX=7227 GN=Aps PE=1 SV=1
11	S4R435	1.15e-37	130	198	0.365	0.333	S4R435_HUMAN RPS10-NUDT3 readthrough (Fragment) OS=Homo sapiens OX=9606 GN=RPS10-NUDT3 PE=3 SV=2
12	Q9LE73	9.37e-11	60.5	207	0.227	0.198	NUDT4_ARATH Nudix hydrolase 4 OS=Arabidopsis thaliana OX=3702 GN=NUDT4 PE=1 SV=1
13	Q09790	1.15e-07	52.0	210	0.155	0.133	APS1_SCHPO Diphosphoinositol polyphosphate phosphohydrolase aps1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=aps1 PE=1 SV=1
14	Q99321	1.75e-07	51.2	188	0.160	0.154	DDP1_YEAST Diphosphoinositol polyphosphate phosphohydrolase DDP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DDP1 PE=1 SV=3
15	P53370	1.12e-05	46.6	316	0.133	0.076	NUDT6_HUMAN Nucleoside diphosphate-linked moiety X motif 6 OS=Homo sapiens OX=9606 GN=NUDT6 PE=1 SV=2
16	Q52K88	6.44e-05	43.9	202	0.243	0.218	NUD13_ARATH Nudix hydrolase 13, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=NUDT13 PE=1 SV=1
17	A0A0H2URA0	7.28e-05	43.9	203	0.127	0.113	A0A0H2URA0_STRPN MutT/nudix family protein OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=SP_1669 PE=1 SV=1
18	Q8T3N6	0.003	39.7	512	0.105	0.037	Q8T3N6_DROME GM04208p OS=Drosophila melanogaster OX=7227 GN=DCP2 PE=2 SV=1
19	Q9CYC6	0.004	39.3	422	0.210	0.090	DCP2_MOUSE m7GpppN-mRNA hydrolase OS=Mus musculus OX=10090 GN=Dcp2 PE=1 SV=2
20	Q5AU26	0.005	38.9	415	0.166	0.072	Q5AU26_EMENI NAD(+) diphosphatase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_08204 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00293 NUDIX	1e-15	69.3	NUDIX domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000006893

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000022620	0.759	40S ribosomal protein S30
2	61853.ENSNLEP00000005874	0.663	Nudix hydrolase 22
3	61853.ENSNLEP00000013595	0.658	Nudix hydrolase 12
4	61853.ENSNLEP00000006867	0.650	Nudix hydrolase 17
5	61853.ENSNLEP00000024465	0.646	Nudix hydrolase 18
6	61853.ENSNLEP00000003397	0.643	Nudix hydrolase 16
7	61853.ENSNLEP00000014948	0.641	Nudix hydrolase 5
8	61853.ENSNLEP00000002411	0.638	Nudix hydrolase 21
9	61853.ENSNLEP00000019924	0.592	Nudix hydrolase 14
10	61853.ENSNLEP00000008687	0.569	Methyltransferase like 21A
11	61853.ENSNLEP00000011609	0.566	Nudix hydrolase 9
12	61853.ENSNLEP00000011512	0.562	Nudix hydrolase 6
13	61853.ENSNLEP00000019979	0.562	Tetratricopeptide repeat domain 33
14	61853.ENSNLEP00000005513	0.559	Pleckstrin homology domain containing, family A member 5
15	61853.ENSNLEP00000008676	0.559	FAST kinase domains 2
16	61853.ENSNLEP00000003294	0.548	Decapping mRNA 1B
17	61853.ENSNLEP00000008806	0.548	Decapping mRNA 1A
18	61853.ENSNLEP00000006909	0.546	Mitochondrial ribosomal protein L42
19	61853.ENSNLEP00000008144	0.535	DNA-directed RNA polymerase subunit beta
20	61853.ENSNLEP00000005129	0.524	Latexin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016462	1.000	pyrophosphatase activity
GO:0005515	0.996	protein binding
GO:0046872	0.959	metal ion binding
GO:0000287	0.928	magnesium ion binding
GO:0008486	0.848	diphosphoinositol-polyphosphate diphosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0023052	0.985	signaling
GO:0007154	0.982	cell communication
GO:0050794	0.960	regulation of cellular process
GO:0071704	0.889	organic substance metabolic process
GO:0051716	0.888	cellular response to stimulus
GO:0044237	0.887	cellular metabolic process
GO:0044238	0.805	primary metabolic process
GO:0006807	0.771	nitrogen compound metabolic process
GO:0007165	0.737	signal transduction
GO:0019932	0.675	second-messenger-mediated signaling
GO:0034641	0.644	cellular nitrogen compound metabolic process
GO:1901360	0.633	organic cyclic compound metabolic process
GO:0019935	0.631	cyclic-nucleotide-mediated signaling
GO:0046483	0.622	heterocycle metabolic process
GO:0006725	0.622	cellular aromatic compound metabolic process
GO:0006139	0.609	nucleobase-containing compound metabolic process
GO:0019722	0.581	calcium-mediated signaling
GO:0044281	0.436	small molecule metabolic process
GO:0019637	0.429	organophosphate metabolic process
GO:0006796	0.399	phosphate-containing compound metabolic process
GO:0043170	0.374	macromolecule metabolic process
GO:0055086	0.334	nucleobase-containing small molecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.996	cytosol
GO:0070013	0.501	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.6.1.-	1.000	In phosphorus-containing anhydrides.
EC:3.6.1.52	0.848	diphosphoinositol-polyphosphate diphosphatase.

[back to server]