StarFunc result for job id A0A087WTH5

User Input

>input (132 residues)
MPRMILSNTTAVTPFLTKLWQETVQQGGNMSGLARRSPRSGDGKLEALYVLMVLGFFGFF
TLGIMLSYIRSKKLEHSNDPFNVYIESNAWQEKDKAYVQARVLESYRSCYVVENHLAIEQ
PNTHLPETKPSP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P15383	0.323	0.327	5.803E-11	130	0.742	0.754	P15383.pdb.gz	KCNE1_RAT Potassium voltage-gated channel subfamily E member 1 OS=Rattus norvegicus OX=10116 GN=Kcne1 PE=1 SV=1
2	AFDB:A8MWV9	0.271	0.259	5.280E-1	139	0.212	0.201	A8MWV9.pdb.gz	SM34A_HUMAN Small integral membrane protein 34 OS=Homo sapiens OX=9606 GN=SMIM34 PE=2 SV=1
3	AFDB:Q9PT60	0.276	0.080	1.779	655	0.136	0.027	Q9PT60.pdb.gz	RBP1A_XENLA RalA-binding protein 1-A OS=Xenopus laevis OX=8355 GN=ralbp1-a PE=1 SV=3
4	AFDB:A0A286YAE3	0.185	0.204	2.204	114	0.174	0.202	A0A286YAE3.pdb.gz
5	AFDB:Q9Z2S7	0.227	0.220	2.204	137	0.167	0.161	Q9Z2S7.pdb.gz	T22D3_MOUSE TSC22 domain family protein 3 OS=Mus musculus OX=10090 GN=Tsc22d3 PE=1 SV=2
6	AFDB:Q6NTI0	0.231	0.217	3.150	143	0.136	0.126	Q6NTI0.pdb.gz	Q6NTI0_DANRE TSC22 domain family protein 3 isoform 1 OS=Danio rerio OX=7955 GN=zgc:64189 PE=2 SV=1
7	AFDB:Q8R4S8	0.172	0.084	3.150	360	0.129	0.047	Q8R4S8.pdb.gz	CRLF2_RAT Cytokine receptor-like factor 2 OS=Rattus norvegicus OX=10116 GN=Crlf2 PE=1 SV=1
8	PDB:2ndjA	0.206	0.247	3.603	103	0.159	0.204	2ndjA.pdb.gz
9	AFDB:F1LRZ9	0.196	0.073	3.633	454	0.174	0.051	F1LRZ9.pdb.gz	F1LRZ9_RAT RUN domain-containing protein 3A OS=Rattus norvegicus OX=10116 GN=Rundc3a PE=1 SV=1
10	AFDB:Q38AL1	0.214	0.196	3.633	149	0.136	0.121	Q38AL1.pdb.gz	Q38AL1_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.3130 PE=4 SV=1
11	AFDB:Q15311	0.296	0.077	4.191	655	0.212	0.043	Q15311.pdb.gz	RBP1_HUMAN RalA-binding protein 1 OS=Homo sapiens OX=9606 GN=RALBP1 PE=1 SV=3
12	PDB:6v8oO	0.192	0.090	6.852	384	0.159	0.055	6v8oO.pdb.gz	Architecture of the chromatin remodeler RSC and insights into its nucleosome engagement.
13	PDB:7odrM	0.091	0.047	6.852	291	0.068	0.031	7odrM.pdb.gz	Stepwise maturation of the peptidyl transferase region of human mitoribosomes.
14	PDB:7po4M	0.083	0.049	8.490	269	0.068	0.033	7po4M.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
15	PDB:5xtcl	0.197	0.062	9.794	603	0.174	0.038	5xtcl.pdb.gz	Architecture of Human Mitochondrial Respiratory Megacomplex I2III2IV2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6FHJ6	1.35e-94	270	129	0.970	0.992	Q6FHJ6_HUMAN Potassium voltage-gated channel subfamily E member 1 (Fragment) OS=Homo sapiens OX=9606 GN=KCNE1 PE=1 SV=1
2	P15382	8.42e-94	268	129	0.962	0.984	KCNE1_HUMAN Potassium voltage-gated channel subfamily E member 1 OS=Homo sapiens OX=9606 GN=KCNE1 PE=1 SV=1
3	P23299	5.60e-71	210	129	0.735	0.752	KCNE1_MOUSE Potassium voltage-gated channel subfamily E member 1 OS=Mus musculus OX=10090 GN=Kcne1 PE=1 SV=1
4	P15383	7.29e-69	205	130	0.742	0.754	KCNE1_RAT Potassium voltage-gated channel subfamily E member 1 OS=Rattus norvegicus OX=10116 GN=Kcne1 PE=1 SV=1
5	Q9Y6J6	3.88e-09	53.1	123	0.167	0.179	KCNE2_HUMAN Potassium voltage-gated channel subfamily E member 2 OS=Homo sapiens OX=9606 GN=KCNE2 PE=1 SV=1
6	P63161	6.83e-08	49.7	123	0.144	0.154	KCNE2_RAT Potassium voltage-gated channel subfamily E member 2 OS=Rattus norvegicus OX=10116 GN=Kcne2 PE=1 SV=1
7	Q9D808	2.02e-07	48.5	123	0.152	0.163	KCNE2_MOUSE Potassium voltage-gated channel subfamily E member 2 OS=Mus musculus OX=10090 GN=Kcne2 PE=1 SV=2
8	Q71FD8	3.36e-05	43.5	170	0.174	0.135	Q71FD8_RAT Potassium voltage-gated channel subfamily E regulatory subunit 4 OS=Rattus norvegicus OX=10116 GN=Kcne4 PE=3 SV=1
9	Q8WWG9	2.24e-04	41.6	221	0.152	0.090	KCNE4_HUMAN Potassium voltage-gated channel subfamily E member 4 OS=Homo sapiens OX=9606 GN=KCNE4 PE=1 SV=4
10	Q9WTW2	4.14e-04	39.3	103	0.129	0.165	KCNE3_MOUSE Potassium voltage-gated channel subfamily E member 3 OS=Mus musculus OX=10090 GN=Kcne3 PE=3 SV=1
11	Q2N1I1	4.51e-04	39.3	99	0.129	0.172	Q2N1I1_HUMAN Cardiac voltage-gated potassium channel accessory subunit isoform 3a (Fragment) OS=Homo sapiens OX=9606 GN=KCNE3 PE=1 SV=1
12	Q6IAE6	4.78e-04	39.3	103	0.129	0.165	Q6IAE6_HUMAN KCNE3 protein OS=Homo sapiens OX=9606 GN=KCNE3 PE=2 SV=1
13	Q9Y6H6	4.78e-04	39.3	103	0.129	0.165	KCNE3_HUMAN Potassium voltage-gated channel subfamily E member 3 OS=Homo sapiens OX=9606 GN=KCNE3 PE=1 SV=1
14	Q9JJV7	0.003	37.4	107	0.121	0.150	KCNE3_RAT Potassium voltage-gated channel subfamily E member 3 OS=Rattus norvegicus OX=10116 GN=Kcne3 PE=1 SV=1
15	Q9UJ90	0.034	34.7	142	0.121	0.113	KCNE5_HUMAN Potassium voltage-gated channel subfamily E regulatory beta subunit 5 OS=Homo sapiens OX=9606 GN=KCNE5 PE=1 SV=1
16	P02816	0.24	32.3	146	0.144	0.130	PIP_MOUSE Prolactin-inducible protein homolog OS=Mus musculus OX=10090 GN=Pip PE=2 SV=3
17	Q5FBC4	1.3	30.8	1400	0.114	0.011	TMCC_DICDI Tiny macrocysts protein C OS=Dictyostelium discoideum OX=44689 GN=tmcC PE=2 SV=1
18	P14200	1.9	30.0	165	0.159	0.127	MCH_RAT Pro-MCH OS=Rattus norvegicus OX=10116 GN=Pmch PE=1 SV=1
19	Q5FBC3	2.1	30.4	1416	0.106	0.010	TMCB_DICDI Tiny macrocysts protein B OS=Dictyostelium discoideum OX=44689 GN=tmcB PE=2 SV=1
20	P56942	2.3	29.6	165	0.159	0.127	MCH_MOUSE Pro-MCH OS=Mus musculus OX=10090 GN=Pmch PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16319 DUF4958	5.6e+02	9.9	Domain of unknown function (DUF4958)
2	PF02060 ISK_Channel	8.2e-65	227.6	Slow voltage-gated potassium channel

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000485125

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000155840	0.925	Potassium voltage-gated channel subfamily KQT member 1
2	9606.ENSP00000309591	0.800	cAMP-dependent protein kinase catalytic subunit alpha
3	9606.ENSP00000337255	0.800	Potassium voltage-gated channel subfamily E member 1
4	9606.ENSP00000359719	0.800	cAMP-dependent protein kinase catalytic subunit beta
5	9606.ENSP00000366488	0.800	cAMP-dependent protein kinase catalytic subunit gamma

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0015459	1.000	potassium channel regulator activity
GO:0005251	0.999	delayed rectifier potassium channel activity
GO:0044325	0.940	transmembrane transporter binding
GO:0044877	0.853	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0055085	0.993	transmembrane transport
GO:0006813	0.992	potassium ion transport
GO:0032501	0.991	multicellular organismal process
GO:0042221	0.990	response to chemical
GO:0071407	0.983	cellular response to organic cyclic compound
GO:0071417	0.980	cellular response to organonitrogen compound
GO:0046683	0.978	response to organophosphorus
GO:0014074	0.978	response to purine-containing compound
GO:0071805	0.978	potassium ion transmembrane transport
GO:0032409	0.976	regulation of transporter activity
GO:1901701	0.976	cellular response to oxygen-containing compound
GO:0003008	0.975	system process
GO:0034762	0.975	regulation of transmembrane transport
GO:0071320	0.972	cellular response to cAMP
GO:0065008	0.968	regulation of biological quality
GO:0008016	0.966	regulation of heart contraction
GO:1904062	0.962	regulation of monoatomic cation transmembrane transport
GO:0032412	0.959	regulation of monoatomic ion transmembrane transporter activity
GO:1901379	0.954	regulation of potassium ion transmembrane transport
GO:0061337	0.943	cardiac conduction
GO:1901016	0.938	regulation of potassium ion transmembrane transporter activity
GO:0043267	0.921	negative regulation of potassium ion transport
GO:2001257	0.921	regulation of cation channel activity
GO:0060047	0.902	heart contraction
GO:0034763	0.882	negative regulation of transmembrane transport
GO:0042391	0.816	regulation of membrane potential
GO:0034766	0.803	negative regulation of monoatomic ion transmembrane transport
GO:0002027	0.771	regulation of heart rate
GO:0032413	0.735	negative regulation of ion transmembrane transporter activity
GO:1904063	0.730	negative regulation of cation transmembrane transport
GO:0006941	0.611	striated muscle contraction
GO:0051050	0.574	positive regulation of transport
GO:2001258	0.527	negative regulation of cation channel activity
GO:0043270	0.445	positive regulation of monoatomic ion transport
GO:1901381	0.436	positive regulation of potassium ion transmembrane transport
GO:0032502	0.416	developmental process
GO:0048856	0.414	anatomical structure development
GO:0001508	0.410	action potential
GO:0060048	0.394	cardiac muscle contraction
GO:0070252	0.392	actin-mediated cell contraction
GO:0086001	0.389	cardiac muscle cell action potential

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008076	0.995	voltage-gated potassium channel complex
GO:0043227	0.987	membrane-bounded organelle
GO:0005737	0.987	cytoplasm
GO:0043229	0.986	intracellular organelle
GO:0043231	0.984	intracellular membrane-bounded organelle
GO:0098590	0.595	plasma membrane region
GO:0012505	0.594	endomembrane system
GO:0009986	0.558	cell surface
GO:0043232	0.436	intracellular non-membrane-bounded organelle
GO:0005783	0.369	endoplasmic reticulum
GO:0030018	0.329	Z disc
GO:0005794	0.323	Golgi apparatus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29463	1.000	K(+)(in) = K(+)(out)

[back to server]