StarFunc result for job id A0A087WUL8

User Input

>input (1400 residues)
MVVSAGPWSSEKAEMNILEINETLRPQLAEKKQQFRNLKEKCFLTQLAGFLANRQKKYKY
EECKDLIKFMLRNERQFKEEKLAEQLKQAEELRQYKVLFHSQERELTQLREKLREGRDAS
RSLNEHLQALLTPDEPDKSQGQDLQEQLAEGCRLAQHLVQKLSPENDNDDDEDVQVEVAE
KVQKSSAPREMQKAEEKEVPEDSLEECAITYSNSHGPYDSNQPHRKTKITFEEDKVDSTL
IGSSSHVEWEDAVHIIPENESDDEEEEEKGPVSPRNLQESEEEEVPQESWDEGYSTLSIP
PEMLASYQSYSSTFHSLEEQQVCMAVDIGRHRWDQVKKEDQEATGPRLSRELLDEKGPEV
LQDSLDRCYSTPSGCLELTDSCQPYRSAFYVLEQQRVGLAIDMDEIEKYQEVEEDQDPSC
PRLSRELLDEKEPEVLQDSLDRCYSIPSGYLELPDLGQPYSSAVYSLEEQYLGLALDVDR
IKKDQEEEEDQDPPCPRLSRELVEVVEPEVLQDSLDRCYSTPSSCLEQPDSCQPYGSSFY
ALEEKHVGFSLDVGEIEKKGKGKKRRGRRSKKERRRGRKEGEEDQNPPCPRLSRELLDEK
GPEVLQDSLDRCYSTPSGCLELTDSCQPYRSAFYILEQQCVGLAVDMDEIEKYQEVEEDQ
DPSCPRLSRELLDEKEPEVLQDSLDRCYSIPSGYLELPDLGQPYSSAVYSLEEQYLGLAL
DVDRIKKDQEEEEDQDPPCPRLSRELVEVVEPEVLQDSLDRCYSTPSSCLEQPDSCQPYG
SSFYALEEKHVGFSLDVGEIEKKGKGKKRRGRRSKKERRRGRKEGEEDQNPPCPRLSREL
LDEKGPEVLQDSLDRCYSTPSGCLELTDSCQPYRSAFYILEQQCVGLAIDMDEIEKYQEV
EEDQDPSCPRLSRELLDEKEPEVLQDSLDRCYSIPSGYLELPDLGQPYSSAVYSLEEQYL
GLALDVDRIKKDQEEEEDQDPPCPRLSRELVEVVEPEVLQDSLDRCYSTPSSCLEQPDSC
QPYGSSFYALEEKHVGFSLDVGEIEKKGKGKKRRGRRSKKERRRGRKEGEEDQNPPCPRL
SRELLDEKGPEVLQDSLDRCYSTPSGCLELTDSCQPYRSAFYILEQQCVGLAVDMDEIEK
YQEVEEDQDPSCPRLSRELLDEKEPEVLQDSLDRCYSIPSGYLELPDLGQPYSSAVYSLE
EQYLGLALDVDRIKKDQEEEEDQDPPCPRLSRELVEVVEPEVLQDSLDRCYSTPSSCLEQ
PDSCQPYGSSFYALEEKHVGFSLDVGEIEKKGKGKKRRGRRSKKERRRGRKEGEEDQNPP
CPRLSRELLDEKGPEVLQDSLDRCYSTPSGCLELTDSCQPYRSAFYILEQQCVGLAVDMD
EIEKYQEVEEDQDPSCPRLS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5TI25	0.091	0.129	2.770E-87	921	0.606	0.922	Q5TI25.pdb.gz	NBPFE_HUMAN Neuroblastoma breakpoint family member 14 OS=Homo sapiens OX=9606 GN=NBPF14 PE=2 SV=2
2	AFDB:Q61484	0.030	0.033	5.733E-3	1231	0.147	0.167	Q61484.pdb.gz	Q61484_MOUSE Desmoyokin (Fragment) OS=Mus musculus OX=10090 GN=Ahnak PE=2 SV=1
3	AFDB:A0JLR7	0.026	0.032	5.305E-2	1069	0.145	0.190	A0JLR7.pdb.gz	A0JLR7_MOUSE Ahnak protein (Fragment) OS=Mus musculus OX=10090 GN=Ahnak PE=2 SV=1
4	AFDB:B4DTV0	0.029	0.036	5.653E-2	1079	0.119	0.154	B4DTV0.pdb.gz	B4DTV0_HUMAN cDNA FLJ57801, highly similar to Homo sapiens AHNAK nucleoprotein (desmoyokin) (AHNAK), transcript variant 1, mRNA (Fragment) OS=Homo sapiens OX=9606 PE=2 SV=1
5	AFDB:P19246	0.042	0.053	1.467E-1	1090	0.081	0.104	P19246.pdb.gz	NFH_MOUSE Neurofilament heavy polypeptide OS=Mus musculus OX=10090 GN=Nefh PE=1 SV=3
6	AFDB:Q8BKS2	0.037	0.045	2.289E-1	939	0.116	0.173	Q8BKS2.pdb.gz	Q8BKS2_MOUSE Ahnak protein (Fragment) OS=Mus musculus OX=10090 GN=Ahnak PE=2 SV=2
7	AFDB:O55103	0.030	0.030	3.572E-1	1391	0.140	0.141	O55103.pdb.gz	PRAX_MOUSE Periaxin OS=Mus musculus OX=10090 GN=Prx PE=1 SV=1
8	AFDB:Q5VV67	0.030	0.032	3.572E-1	1664	0.153	0.129	Q5VV67.pdb.gz	PPRC1_HUMAN Peroxisome proliferator-activated receptor gamma coactivator-related protein 1 OS=Homo sapiens OX=9606 GN=PPRC1 PE=1 SV=1
9	AFDB:Q9W283	0.032	0.033	5.940E-1	1329	0.109	0.114	Q9W283.pdb.gz	Q9W283_DROME Arc, isoform A OS=Drosophila melanogaster OX=7227 GN=a PE=2 SV=2
10	AFDB:I3ISS1	0.039	0.033	8.163E-1	1803	0.130	0.101	I3ISS1.pdb.gz
11	PDB:6q56A	0.027	0.126	1.505	234	0.006	0.034	6q56A.pdb.gz
12	PDB:2p22C	0.042	0.237	1.709	186	0.020	0.151	2p22C.pdb.gz
13	PDB:1wleB	0.031	0.072	2.668	469	0.009	0.026	1wleB.pdb.gz	Dual-mode recognition of noncanonical tRNAs(Ser) by seryl-tRNA synthetase in mammalian mitochondria
14	PDB:6qw65B	0.026	0.019	3.228	2001	0.014	0.010	6qw65B.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
15	PDB:3c98B	0.031	0.141	3.666	230	0.007	0.043	3c98B.pdb.gz
16	PDB:3lssA	0.030	0.078	3.666	438	0.006	0.021	3lssA.pdb.gz	X-ray crystal structure of Seryl-tRNA synthetase from the eukaryotic parasite Trypanosoma brucei.
17	PDB:5ng5A	0.026	0.070	3.666	340	0.007	0.029	5ng5A.pdb.gz	An allosteric transport mechanism for the AcrAB-TolC Multidrug Efflux Pump.
18	PDB:7q83D	0.031	0.203	4.163	156	0.007	0.064	7q83D.pdb.gz
19	PDB:7s8tJ	0.033	0.313	4.163	83	0.009	0.157	7s8tJ.pdb.gz	Structural characterization of the Myxococcus xanthus encapsulin and ferritin-like cargo system gives insight into its iron storage mechanism.
20	PDB:7z37DP1	0.043	0.196	4.163	273	0.010	0.051	7z37DP1.pdb.gz	Structure of the RAF1-HSP90-CDC37 complex reveals the basis of RAF1 regulation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087WUL8	0.0	1144	3843	0.516	0.188	NBPFJ_HUMAN Neuroblastoma breakpoint family member 19 OS=Homo sapiens OX=9606 GN=NBPF19 PE=5 SV=1
2	A0A2K7P776	0.0	845	867	0.339	0.547	A0A2K7P776_HUMAN NBPF9 isoform 1 OS=Homo sapiens OX=9606 PE=1 SV=1
3	P0DPF2	0.0	1142	5207	0.518	0.139	NBPFK_HUMAN Neuroblastoma breakpoint family member 20 OS=Homo sapiens OX=9606 GN=NBPF20 PE=3 SV=1
4	P0DPF3	0.0	1248	1111	0.509	0.641	NBPF9_HUMAN Neuroblastoma breakpoint family member 9 OS=Homo sapiens OX=9606 GN=NBPF9 PE=2 SV=1
5	Q3BBV0	0.0	1060	1214	0.420	0.484	NBPF1_HUMAN Neuroblastoma breakpoint family member 1 OS=Homo sapiens OX=9606 GN=NBPF1 PE=1 SV=2
6	Q5TI25	0.0	1336	921	0.550	0.836	NBPFE_HUMAN Neuroblastoma breakpoint family member 14 OS=Homo sapiens OX=9606 GN=NBPF14 PE=2 SV=2
7	Q6P3W6	0.0	1138	3795	0.518	0.191	NBPFA_HUMAN Neuroblastoma breakpoint family member 10 OS=Homo sapiens OX=9606 GN=NBPF10 PE=3 SV=3
8	Q5VU43	9.65e-09	62.8	2346	0.040	0.024	MYOME_HUMAN Myomegalin OS=Homo sapiens OX=9606 GN=PDE4DIP PE=1 SV=3
9	B7ZNY0	7.82e-08	59.7	2412	0.040	0.023	B7ZNY0_MOUSE Pde4dip protein OS=Mus musculus OX=10090 GN=Pde4dip PE=1 SV=1
10	Q80YT7	7.94e-08	59.7	2224	0.040	0.025	MYOME_MOUSE Myomegalin OS=Mus musculus OX=10090 GN=Pde4dip PE=1 SV=2
11	M9PI41	0.078	40.0	1858	0.031	0.024	M9PI41_DROME Sticky, isoform B OS=Drosophila melanogaster OX=7227 GN=sti PE=1 SV=1
12	Q9VTY8	0.079	40.0	1854	0.031	0.024	Q9VTY8_DROME FI02033p OS=Drosophila melanogaster OX=7227 GN=sti PE=1 SV=2
13	A8JGW5	8.8	33.1	380	0.024	0.087	A8JGW5_CHLRE Nucleoside diphosphate kinase OS=Chlamydomonas reinhardtii OX=3055 GN=CHLRE_12g558700v5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16523 betaPIX_CC	52	15.1	betaPIX coiled coil
2	PF14617 CMS1	1.3	19.9	U3-containing 90S pre-ribosomal complex subunit
3	PF05842 Euplotes_phero	6.5e-07	41.4	Euplotes octocarinatus mating pheromone protein
4	PF03127 GAT	42	15.8	GAT domain
5	PF06758 Olduvai	0	1209.4	Olduvai domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000478752

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000464060	0.601	Notch homolog 2 N-terminal-like protein
2	9606.ENSP00000349891	0.556	Ankyrin repeat domain-containing protein 20A4
3	9606.ENSP00000366826	0.520	Ankyrin repeat domain-containing protein 20A2
4	9606.ENSP00000438757	0.518	Proline-rich protein 20A
5	9606.ENSP00000367164	0.509	Proline rich 20A
6	9606.ENSP00000392407	0.508	Proline rich 20D
7	9606.ENSP00000366608	0.504	COBW domain-containing protein 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.647	biological regulation
GO:0050789	0.503	regulation of biological process
GO:0009987	0.488	cellular process
GO:0050794	0.387	regulation of cellular process
GO:0007010	0.333	cytoskeleton organization
GO:0007049	0.313	cell cycle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043229	0.999	intracellular organelle
GO:0043227	0.942	membrane-bounded organelle
GO:0043232	0.910	intracellular non-membrane-bounded organelle
GO:0005856	0.883	cytoskeleton
GO:0043231	0.879	intracellular membrane-bounded organelle
GO:0005634	0.572	nucleus
GO:0071944	0.550	cell periphery
GO:0012505	0.434	endomembrane system
GO:0016020	0.387	membrane
GO:0070013	0.357	intracellular organelle lumen
GO:0031981	0.315	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]