StarFunc result for job id A0A087X1L8

User Input

>input (192 residues)
MRLGSPGLLFLLFSSLRAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDN
SLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIG
ERDKITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETE
LTESWNLLLLLS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:K4DIA0	0.520	0.214	8.408E-25	473	0.859	0.349	K4DIA0.pdb.gz	K4DIA0_HUMAN Inducible T cell costimulator ligand OS=Homo sapiens OX=9606 GN=ICOSLG PE=1 SV=1
2	AFDB:Q9JHJ8	0.490	0.298	9.356E-13	322	0.359	0.214	Q9JHJ8.pdb.gz	ICOSL_MOUSE ICOS ligand OS=Mus musculus OX=10090 GN=Icoslg PE=1 SV=1
3	AFDB:Q8VE98	0.447	0.276	5.297E-9	316	0.240	0.146	Q8VE98.pdb.gz	CD276_MOUSE CD276 antigen OS=Mus musculus OX=10090 GN=Cd276 PE=1 SV=1
4	AFDB:Q5ZPR3	0.452	0.167	1.244E-8	534	0.234	0.084	Q5ZPR3.pdb.gz	CD276_HUMAN CD276 antigen OS=Homo sapiens OX=9606 GN=CD276 PE=1 SV=1
5	AFDB:Q13410	0.449	0.168	3.582E-7	526	0.182	0.067	Q13410.pdb.gz	BT1A1_HUMAN Butyrophilin subfamily 1 member A1 OS=Homo sapiens OX=9606 GN=BTN1A1 PE=1 SV=3
6	AFDB:G3V671	0.431	0.267	3.779E-7	321	0.203	0.121	G3V671.pdb.gz	G3V671_RAT Cd80 molecule OS=Rattus norvegicus OX=10116 GN=Cd80 PE=4 SV=2
7	AFDB:Q62556	0.429	0.164	5.204E-7	524	0.198	0.073	Q62556.pdb.gz	BT1A1_MOUSE Butyrophilin subfamily 1 member A1 OS=Mus musculus OX=10090 GN=Btn1a1 PE=1 SV=2
8	AFDB:Q9JLN5	0.463	0.164	7.559E-7	566	0.172	0.058	Q9JLN5.pdb.gz	ERMAP_MOUSE Erythroid membrane-associated protein OS=Mus musculus OX=10090 GN=Ermap PE=1 SV=2
9	AFDB:P01902	0.436	0.241	7.974E-7	368	0.177	0.092	P01902.pdb.gz	HA1D_MOUSE H-2 class I histocompatibility antigen, K-D alpha chain OS=Mus musculus OX=10090 GN=H2-K1 PE=1 SV=1
10	AFDB:Q8WVV5	0.446	0.168	8.871E-7	523	0.151	0.055	Q8WVV5.pdb.gz	BT2A2_HUMAN Butyrophilin subfamily 2 member A2 OS=Homo sapiens OX=9606 GN=BTN2A2 PE=1 SV=2
11	PDB:5c7kF	0.423	0.386	1.368E-4	212	0.115	0.104	5c7kF.pdb.gz	Complete epitopes for vaccine design derived from a crystal structure of the broadly neutralizing antibodies PGT128 and 8ANC195 in complex with an HIV-1 Env trimer.
12	PDB:6d7gA	0.382	0.203	1.522E-4	386	0.083	0.041	6d7gA.pdb.gz
13	PDB:2qriA	0.409	0.214	1.693E-4	398	0.094	0.045	2qriA.pdb.gz
14	PDB:3nwmA	0.407	0.220	2.210E-4	384	0.115	0.057	3nwmA.pdb.gz
15	PDB:7czpH	0.387	0.339	2.332E-4	222	0.099	0.086	7czpH.pdb.gz
16	PDB:3u0wL	0.384	0.349	2.459E-4	213	0.115	0.103	3u0wL.pdb.gz
17	PDB:4hixL	0.365	0.324	2.594E-4	219	0.115	0.100	4hixL.pdb.gz	Bapineuzumab captures the N-terminus of the Alzheimer's disease amyloid-beta peptide in a helical conformation.
18	PDB:4xnyL	0.385	0.353	2.594E-4	211	0.115	0.104	4xnyL.pdb.gz
19	PDB:1gafL	0.382	0.347	2.736E-4	214	0.115	0.103	1gafL.pdb.gz	The immunological evolution of catalysis.
20	PDB:3u7wL	0.382	0.353	3.387E-4	210	0.115	0.105	3u7wL.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0N0L8	1.86e-119	342	302	0.859	0.546	A0N0L8_HUMAN Inducible T-cell co-stimulator ligand OS=Homo sapiens OX=9606 GN=ICOSLG PE=2 SV=1
2	O75144	1.86e-119	342	302	0.859	0.546	ICOSL_HUMAN ICOS ligand OS=Homo sapiens OX=9606 GN=ICOSLG PE=1 SV=2
3	K4DIA0	6.08e-116	339	473	0.859	0.349	K4DIA0_HUMAN Inducible T cell costimulator ligand OS=Homo sapiens OX=9606 GN=ICOSLG PE=1 SV=1
4	Q9JHJ8	6.70e-32	119	322	0.339	0.202	ICOSL_MOUSE ICOS ligand OS=Mus musculus OX=10090 GN=Icoslg PE=1 SV=1
5	Q5ZPR3	2.62e-07	52.0	534	0.198	0.071	CD276_HUMAN CD276 antigen OS=Homo sapiens OX=9606 GN=CD276 PE=1 SV=1
6	Q8VE98	5.52e-06	47.8	316	0.161	0.098	CD276_MOUSE CD276 antigen OS=Mus musculus OX=10090 GN=Cd276 PE=1 SV=1
7	Q62556	5.19e-04	42.4	524	0.130	0.048	BT1A1_MOUSE Butyrophilin subfamily 1 member A1 OS=Mus musculus OX=10090 GN=Btn1a1 PE=1 SV=2
8	Q13410	0.002	40.4	526	0.115	0.042	BT1A1_HUMAN Butyrophilin subfamily 1 member A1 OS=Homo sapiens OX=9606 GN=BTN1A1 PE=1 SV=3
9	Q9BQ51	0.010	38.1	273	0.193	0.136	PD1L2_HUMAN Programmed cell death 1 ligand 2 OS=Homo sapiens OX=9606 GN=PDCD1LG2 PE=1 SV=2
10	Q9WUL5	0.016	37.4	247	0.125	0.097	PD1L2_MOUSE Programmed cell death 1 ligand 2 OS=Mus musculus OX=10090 GN=Pdcd1lg2 PE=1 SV=1
11	Q5U176	0.028	37.4	1340	0.125	0.018	Q5U176_DROME RE21729p OS=Drosophila melanogaster OX=7227 GN=robo2 PE=2 SV=1
12	M9PC46	0.029	37.4	1519	0.125	0.016	M9PC46_DROME Roundabout 2, isoform B OS=Drosophila melanogaster OX=7227 GN=robo2 PE=4 SV=1
13	Q9VQ08	0.031	37.0	1463	0.125	0.016	Q9VQ08_DROME FI23903p1 OS=Drosophila melanogaster OX=7227 GN=robo2 PE=2 SV=2
14	Q9GPP7	0.032	37.0	1406	0.125	0.017	Q9GPP7_DROME Roundabout 2 OS=Drosophila melanogaster OX=7227 GN=robo2 PE=2 SV=1
15	Q00609	0.096	35.0	306	0.120	0.075	CD80_MOUSE T-lymphocyte activation antigen CD80 OS=Mus musculus OX=10090 GN=Cd80 PE=1 SV=1
16	G3V671	0.14	34.7	324	0.135	0.080	G3V671_RAT Cd80 molecule OS=Rattus norvegicus OX=10116 GN=Cd80 PE=4 SV=2
17	O35187	0.16	34.7	321	0.135	0.081	O35187_RAT B7.1 OS=Rattus norvegicus OX=10116 GN=Cd80 PE=2 SV=1
18	Q7TST0	0.17	34.7	509	0.130	0.049	BTNL1_MOUSE Butyrophilin-like protein 1 OS=Mus musculus OX=10090 GN=Btnl1 PE=2 SV=3
19	Q61490	0.45	33.5	583	0.161	0.053	CD166_MOUSE CD166 antigen OS=Mus musculus OX=10090 GN=Alcam PE=1 SV=3
20	Q9UIR0	0.50	33.1	455	0.135	0.057	BTNL2_HUMAN Butyrophilin-like protein 2 OS=Homo sapiens OX=9606 GN=BTNL2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08205 C2-set_2	0.66	21.4	CD80-like C2-set immunoglobulin domain
2	PF19865 DUF6338	1.8e+02	13.0	Family of unknown function (DUF6338)
3	PF13927 Ig_3	6.3	18.8	Immunoglobulin domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000483732

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000319476	0.995	Inducible T-cell costimulator
2	9606.ENSP00000303939	0.989	Cytotoxic T-lymphocyte protein 4
3	9606.ENSP00000324890	0.869	T-cell-specific surface glycoprotein CD28
4	9606.ENSP00000339477	0.800	Inducible T-cell co-stimulator ligand
5	9606.ENSP00000281834	0.756	Tumor necrosis factor ligand superfamily member 4
6	9606.ENSP00000368538	0.750	Tumor necrosis factor receptor superfamily member 4
7	9606.ENSP00000361359	0.738	Tumor necrosis factor receptor superfamily member 5
8	9606.ENSP00000011653	0.723	T-cell surface glycoprotein CD4
9	9606.ENSP00000292174	0.711	C-X-C chemokine receptor type 5
10	9606.ENSP00000359663	0.711	CD40 ligand
11	9606.ENSP00000358470	0.709	V-set domain-containing T-cell activation inhibitor 1
12	9606.ENSP00000365380	0.683	Forkhead box protein P3
13	9606.ENSP00000245817	0.675	Tumor necrosis factor ligand superfamily member 9
14	9606.ENSP00000304467	0.660	Thimet oligopeptidase
15	9606.ENSP00000412237	0.659	Interleukin-10
16	9606.ENSP00000231368	0.652	Leucyl-cystinyl aminopeptidase
17	9606.ENSP00000386559	0.652	T-cell surface glycoprotein CD8 alpha chain
18	9606.ENSP00000404833	0.644	Tapasin
19	9606.ENSP00000365233	0.643	Tripeptidyl-peptidase 2
20	9606.ENSP00000384371	0.642	B-cell lymphoma 6 protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005102	0.652	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008284	0.996	positive regulation of cell population proliferation
GO:0002682	0.994	regulation of immune system process
GO:0032944	0.976	regulation of mononuclear cell proliferation
GO:0050670	0.973	regulation of lymphocyte proliferation
GO:0042129	0.958	regulation of T cell proliferation
GO:0051240	0.951	positive regulation of multicellular organismal process
GO:0070665	0.950	positive regulation of leukocyte proliferation
GO:1903037	0.945	regulation of leukocyte cell-cell adhesion
GO:0002684	0.938	positive regulation of immune system process
GO:0045785	0.914	positive regulation of cell adhesion
GO:0050867	0.906	positive regulation of cell activation
GO:0002696	0.903	positive regulation of leukocyte activation
GO:0022409	0.902	positive regulation of cell-cell adhesion
GO:0032946	0.889	positive regulation of mononuclear cell proliferation
GO:0051251	0.868	positive regulation of lymphocyte activation
GO:1903039	0.846	positive regulation of leukocyte cell-cell adhesion
GO:0050870	0.840	positive regulation of T cell activation
GO:0050671	0.803	positive regulation of lymphocyte proliferation
GO:0042102	0.756	positive regulation of T cell proliferation
GO:0050896	0.406	response to stimulus
GO:0019222	0.404	regulation of metabolic process
GO:0046006	0.352	regulation of activated T cell proliferation
GO:0060255	0.322	regulation of macromolecule metabolic process
GO:0009987	0.319	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043229	0.996	intracellular organelle
GO:0005737	0.995	cytoplasm
GO:0043232	0.848	intracellular non-membrane-bounded organelle
GO:0099080	0.684	supramolecular complex
GO:0043227	0.622	membrane-bounded organelle
GO:0035770	0.575	ribonucleoprotein granule
GO:0036464	0.568	cytoplasmic ribonucleoprotein granule
GO:0043231	0.476	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]