StarFunc result for job id A0A096LNP1

User Input

>input (70 residues)
MRVLFFVFGVLSLMSTVPPTRSFTSNDECPSEYYHCRLKCNADEHAIRYCADFSICCKLK
IIQIDGQKKW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P59861	0.755	0.755	7.339E-13	70	0.943	0.943	P59861.pdb.gz	D131A_HUMAN Beta-defensin 131A OS=Homo sapiens OX=9606 GN=DEFB131A PE=1 SV=2
2	AFDB:Q8NET1	0.495	0.477	3.076E-4	73	0.243	0.233	Q8NET1.pdb.gz	D108B_HUMAN Beta-defensin 108B OS=Homo sapiens OX=9606 GN=DEFB108B PE=1 SV=3
3	AFDB:Q8NES8	0.445	0.439	1.102E-3	71	0.229	0.225	Q8NES8.pdb.gz	DB124_HUMAN Beta-defensin 124 OS=Homo sapiens OX=9606 GN=DEFB124 PE=1 SV=2
4	AFDB:Q96PH6	0.446	0.266	1.944E-3	123	0.229	0.130	Q96PH6.pdb.gz	DB118_HUMAN Defensin beta 118 OS=Homo sapiens OX=9606 GN=DEFB118 PE=1 SV=1
5	AFDB:Q8N690	0.445	0.375	2.086E-3	84	0.229	0.190	Q8N690.pdb.gz	DB119_HUMAN Beta-defensin 119 OS=Homo sapiens OX=9606 GN=DEFB119 PE=2 SV=2
6	AFDB:Q95LI0	0.444	0.265	2.581E-3	123	0.214	0.122	Q95LI0.pdb.gz	DB118_MACMU Defensin beta 118 OS=Macaca mulatta OX=9544 GN=DEFB118 PE=2 SV=1
7	AFDB:Q8WTQ1	0.451	0.443	3.193E-3	72	0.243	0.236	Q8WTQ1.pdb.gz	D104A_HUMAN Beta-defensin 104 OS=Homo sapiens OX=9606 GN=DEFB104A PE=1 SV=2
8	AFDB:Q30KQ6	0.507	0.513	3.950E-3	69	0.243	0.246	Q30KQ6.pdb.gz	DB114_HUMAN Beta-defensin 114 OS=Homo sapiens OX=9606 GN=DEFB114 PE=1 SV=1
9	AFDB:Q6IV18	0.470	0.386	4.886E-3	89	0.257	0.202	Q6IV18.pdb.gz	GLL13_CHICK Gallinacin-13 OS=Gallus gallus OX=9031 GN=GAL13 PE=2 SV=1
10	AFDB:Q5J5C9	0.403	0.373	5.245E-3	76	0.229	0.211	Q5J5C9.pdb.gz	DB121_HUMAN Beta-defensin 121 OS=Homo sapiens OX=9606 GN=DEFB121 PE=1 SV=1
11	PDB:2lwlA	0.335	0.503	2.065E-1	45	0.100	0.156	2lwlA.pdb.gz
12	PDB:6cs9A	0.379	0.579	4.197E-1	41	0.114	0.195	6cs9A.pdb.gz	Human beta-defensin 2 killsCandida albicansthrough phosphatidylinositol 4,5-bisphosphate-mediated membrane permeabilization.
13	PDB:1kj6A	0.362	0.520	9.155E-1	45	0.129	0.200	1kj6A.pdb.gz
14	PDB:1e4rA	0.297	0.506	1.401	35	0.114	0.229	1e4rA.pdb.gz
15	PDB:1bnbA	0.341	0.548	1.504	38	0.100	0.184	1bnbA.pdb.gz
16	PDB:1d6bA	0.269	0.352	4.677	42	0.114	0.190	1d6bA.pdb.gz
17	PDB:7ac7A	0.174	0.151	5.785	84	0.057	0.048	7ac7A.pdb.gz	Structures of tmRNA and SmpB as they transit through the ribosome.
18	PDB:1q67B	0.189	0.102	6.210	161	0.057	0.025	1q67B.pdb.gz
19	PDB:2af6G	0.188	0.062	6.210	246	0.057	0.016	2af6G.pdb.gz	Structure of the Mycobacterium tuberculosis Flavin Dependent Thymidylate Synthase (MtbThyX) at 2.0A Resolution.
20	PDB:5j0aB	0.266	0.079	6.210	303	0.157	0.036	5j0aB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P59861	1.06e-45	142	70	0.943	0.943	D131A_HUMAN Beta-defensin 131A OS=Homo sapiens OX=9606 GN=DEFB131A PE=1 SV=2
2	Q30KQ6	0.13	30.4	69	0.243	0.246	DB114_HUMAN Beta-defensin 114 OS=Homo sapiens OX=9606 GN=DEFB114 PE=1 SV=1
3	Q6IV18	0.42	29.3	89	0.271	0.213	GLL13_CHICK Gallinacin-13 OS=Gallus gallus OX=9031 GN=GAL13 PE=2 SV=1
4	Q9I7F7	0.54	30.0	1337	0.186	0.010	ACKL_DROME Activated Cdc42 kinase-like OS=Drosophila melanogaster OX=7227 GN=Ack-like PE=1 SV=3
5	Q9SF14	1.00	29.3	504	0.214	0.030	Q9SF14_ARATH F26K24.14 protein OS=Arabidopsis thaliana OX=3702 GN=MYOB8 PE=1 SV=1
6	Q9H1M3	1.2	28.9	183	0.271	0.104	DB129_HUMAN Beta-defensin 129 OS=Homo sapiens OX=9606 GN=DEFB129 PE=1 SV=1
7	Q4QJ70	2.9	27.7	663	0.157	0.017	Q4QJ70_LEIMA Putative ATP-binding cassette protein subfamily G,member 2 OS=Leishmania major OX=5664 GN=ABCG2 PE=4 SV=1
8	A0KYQ7	4.8	27.3	386	0.186	0.034	AGAS_SHESA D-galactosamine-6-phosphate deaminase AgaS OS=Shewanella sp. (strain ANA-3) OX=94122 GN=agaS PE=1 SV=1
9	Q3EBY6	5.6	26.9	416	0.157	0.026	MCAC2_ARATH Protein MID1-COMPLEMENTING ACTIVITY 2 OS=Arabidopsis thaliana OX=3702 GN=MCA2 PE=2 SV=1
10	Q0KIB0	9.0	26.6	1689	0.243	0.010	Q0KIB0_DROME Sidestep III, isoform O OS=Drosophila melanogaster OX=7227 GN=side-III PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13841 Defensin_beta_2	0.00047	31.9	Beta defensin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000485141

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360190	0.559	Beta-defensin 110
2	9606.ENSP00000383396	0.559	Beta-defensin 116

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051707	0.988	response to other organism
GO:0009617	0.983	response to bacterium
GO:0050789	0.970	regulation of biological process
GO:0006952	0.970	defense response
GO:0098542	0.964	defense response to other organism
GO:0006955	0.957	immune response
GO:0050794	0.918	regulation of cellular process
GO:0001817	0.889	regulation of cytokine production
GO:0032103	0.878	positive regulation of response to external stimulus
GO:0009987	0.861	cellular process
GO:2000145	0.841	regulation of cell motility
GO:0071675	0.827	regulation of mononuclear cell migration
GO:0050920	0.825	regulation of chemotaxis
GO:0032642	0.822	regulation of chemokine production
GO:0002687	0.821	positive regulation of leukocyte migration
GO:0050921	0.819	positive regulation of chemotaxis
GO:0001819	0.819	positive regulation of cytokine production
GO:0032722	0.813	positive regulation of chemokine production
GO:0071677	0.812	positive regulation of mononuclear cell migration
GO:0002688	0.809	regulation of leukocyte chemotaxis
GO:0045087	0.784	innate immune response
GO:0002690	0.772	positive regulation of leukocyte chemotaxis
GO:0042221	0.712	response to chemical
GO:0051716	0.660	cellular response to stimulus
GO:0071216	0.653	cellular response to biotic stimulus
GO:0002237	0.647	response to molecule of bacterial origin
GO:1901700	0.619	response to oxygen-containing compound
GO:0070887	0.619	cellular response to chemical stimulus
GO:0071219	0.537	cellular response to molecule of bacterial origin
GO:0042742	0.519	defense response to bacterium
GO:1901701	0.496	cellular response to oxygen-containing compound
GO:0090026	0.316	positive regulation of monocyte chemotaxis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]