StarFunc result for job id A0A096LNW5

User Input

>input (274 residues)
MPALRPALLWALLALWLCWAAPAHALQCRDGYEPCVNKGMCVTYHSGTGYCKCPEGFLGE
YCQHRDPCEKNRCQNGGTCVAQAMLGKATCRCASGFTGEDCQYSTPHPCFVSRPCLNGGT
CHMLSRDTYECTCQVGFTGKECQWTDACLSHLCANGSTCTTVANQFSCKCLTGFTGQKCE
TDVNECDIPGHCQHGGTCLNLPGSYQCQCLQGFTGQYCDRLYVPCAHSPCVNGGTCRQTG
DFTFECNCLPETVRNKRNRALGKRQASLEWKRTR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P0DPK4	0.555	0.639	3.174E-45	236	0.777	0.903	P0DPK4.pdb.gz	NT2NC_HUMAN Notch homolog 2 N-terminal-like protein C OS=Homo sapiens OX=9606 GN=NOTCH2NLC PE=1 SV=2
2	AFDB:O35516	0.353	0.053	1.097E-41	2473	0.788	0.087	O35516.pdb.gz	NOTC2_MOUSE Neurogenic locus notch homolog protein 2 OS=Mus musculus OX=10090 GN=Notch2 PE=1 SV=2
3	AFDB:P46530	0.418	0.058	5.145E-27	2437	0.380	0.043	P46530.pdb.gz	NOTC1_DANRE Neurogenic locus notch homolog protein 1 OS=Danio rerio OX=7955 GN=notch1a PE=2 SV=1
4	AFDB:P21783	0.414	0.057	6.611E-27	2524	0.398	0.043	P21783.pdb.gz	NOTC1_XENLA Neurogenic locus notch homolog protein 1 OS=Xenopus laevis OX=8355 GN=notch1 PE=1 SV=3
5	AFDB:F1RCH4	0.441	0.060	2.175E-26	2475	0.405	0.045	F1RCH4.pdb.gz	F1RCH4_DANRE Neurogenic locus notch homolog protein 2 precursor OS=Danio rerio OX=7955 GN=notch6 PE=3 SV=1
6	AFDB:F1QCA7	0.412	0.056	4.614E-26	2465	0.358	0.040	F1QCA7.pdb.gz
7	AFDB:Q01705	0.366	0.056	2.547E-24	2531	0.391	0.042	Q01705.pdb.gz	NOTC1_MOUSE Neurogenic locus notch homolog protein 1 OS=Mus musculus OX=10090 GN=Notch1 PE=1 SV=3
8	AFDB:Q8UWJ4	0.292	0.126	5.076E-24	717	0.281	0.107	Q8UWJ4.pdb.gz	DLLD_DANRE Delta-like protein D OS=Danio rerio OX=7955 GN=dld PE=1 SV=2
9	AFDB:Q9IAT6	0.312	0.142	7.872E-24	664	0.299	0.123	Q9IAT6.pdb.gz	DLLC_DANRE Delta-like protein C OS=Danio rerio OX=7955 GN=dlc PE=2 SV=1
10	AFDB:Q90656	0.302	0.128	8.381E-24	728	0.274	0.103	Q90656.pdb.gz	Q90656_CHICK Delta-like protein OS=Gallus gallus OX=9031 PE=2 SV=1
11	PDB:7q3nU	0.193	0.183	6.092E-7	292	0.179	0.168	7q3nU.pdb.gz	Structure of the decoy module of human glycoprotein 2 and uromodulin and its interaction with bacterial adhesin FimH.
12	PDB:4g1eB	0.199	0.105	1.539E-3	709	0.168	0.065	4g1eB.pdb.gz	AlphaV Beta3 Integrin Crystal Structures and their Functional Implications
13	PDB:5es4B	0.212	0.116	1.144E-2	674	0.139	0.056	5es4B.pdb.gz	Leukocyte integrin alpha L beta 2 headpiece structures: The alpha I domain, the pocket for the internal ligand, and concerted movements of its loops.
14	PDB:4e0sB	0.130	0.054	4.834E-2	898	0.175	0.053	4e0sB.pdb.gz	Crystal structure of c5b-6 suggests structural basis for priming assembly of the membrane attack complex.
15	PDB:5f1aA	0.126	0.063	4.834E-2	553	0.058	0.029	5f1aA.pdb.gz	Crystal Structure of Aspirin-Acetylated Human Cyclooxygenase-2: Insight into the Formation of Products with Reversed Stereochemistry.
16	PDB:7nxdB	0.141	0.069	6.211E-2	690	0.128	0.051	7nxdB.pdb.gz	Structural insights into integrin alpha 5 beta 1 opening by fibronectin ligand.
17	PDB:4rs0A	0.126	0.062	7.041E-2	557	0.058	0.029	4rs0A.pdb.gz	Action at a Distance: MUTATIONS OF PERIPHERAL RESIDUES TRANSFORM RAPID REVERSIBLE INHIBITORS TO SLOW, TIGHT BINDERS OF CYCLOOXYGENASE-2.
18	PDB:3t5oA	0.122	0.040	7.981E-2	871	0.186	0.059	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).
19	PDB:6dlwA	0.104	0.063	1.590E-1	460	0.055	0.033	6dlwA.pdb.gz	The first transmembrane region of complement component-9 acts as a brake on its self-assembly.
20	PDB:6y3cA	0.125	0.062	2.175E-1	557	0.047	0.023	6y3cA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P0DPK3	1.22e-179	497	275	0.905	0.902	NT2NB_HUMAN Notch homolog 2 N-terminal-like protein B OS=Homo sapiens OX=9606 GN=NOTCH2NLB PE=1 SV=1
2	Q04721	8.24e-163	502	2471	0.883	0.098	NOTC2_HUMAN Neurogenic locus notch homolog protein 2 OS=Homo sapiens OX=9606 GN=NOTCH2 PE=1 SV=3
3	P0DPK4	1.10e-159	447	293	0.825	0.771	NT2NC_HUMAN Notch homolog 2 N-terminal-like protein C OS=Homo sapiens OX=9606 GN=NOTCH2NLC PE=1 SV=2
4	Q7Z3S9	2.05e-151	424	236	0.777	0.903	NT2NA_HUMAN Notch homolog 2 N-terminal-like protein A OS=Homo sapiens OX=9606 GN=NOTCH2NLA PE=1 SV=1
5	O35516	5.32e-138	431	2473	0.788	0.087	NOTC2_MOUSE Neurogenic locus notch homolog protein 2 OS=Mus musculus OX=10090 GN=Notch2 PE=1 SV=2
6	Q9QW30	2.97e-134	421	2471	0.770	0.085	NOTC2_RAT Neurogenic locus notch homolog protein 2 OS=Rattus norvegicus OX=10116 GN=Notch2 PE=1 SV=1
7	F1RCH4	2.97e-62	214	2475	0.412	0.046	F1RCH4_DANRE Neurogenic locus notch homolog protein 2 precursor OS=Danio rerio OX=7955 GN=notch6 PE=3 SV=1
8	A2RUV0	4.51e-55	193	2522	0.423	0.046	NOTC1_XENTR Neurogenic locus notch homolog protein 1 OS=Xenopus tropicalis OX=8364 GN=notch1 PE=1 SV=2
9	P46530	1.49e-51	183	2437	0.398	0.045	NOTC1_DANRE Neurogenic locus notch homolog protein 1 OS=Danio rerio OX=7955 GN=notch1a PE=2 SV=1
10	P21783	6.70e-51	181	2524	0.405	0.044	NOTC1_XENLA Neurogenic locus notch homolog protein 1 OS=Xenopus laevis OX=8355 GN=notch1 PE=1 SV=3
11	P07207	2.42e-50	179	2703	0.361	0.037	NOTCH_DROME Neurogenic locus Notch protein OS=Drosophila melanogaster OX=7227 GN=N PE=1 SV=3
12	A0PGH6	3.69e-49	176	2465	0.369	0.041	A0PGH6_DANRE Neurogenic locus notch homolog protein 1 OS=Danio rerio OX=7955 GN=wu:fc55e11 PE=2 SV=1
13	Q01705	4.82e-48	173	2531	0.376	0.041	NOTC1_MOUSE Neurogenic locus notch homolog protein 1 OS=Mus musculus OX=10090 GN=Notch1 PE=1 SV=3
14	P46531	6.26e-48	172	2555	0.380	0.041	NOTC1_HUMAN Neurogenic locus notch homolog protein 1 OS=Homo sapiens OX=9606 GN=NOTCH1 PE=1 SV=4
15	Q07008	9.18e-48	172	2531	0.376	0.041	NOTC1_RAT Neurogenic locus notch homolog protein 1 OS=Rattus norvegicus OX=10116 GN=Notch1 PE=1 SV=3
16	G3I6Z6	3.14e-47	171	2527	0.376	0.041	NOTC1_CRIGR Neurogenic locus notch homolog protein 1 OS=Cricetulus griseus OX=10029 GN=NOTCH1 PE=1 SV=2
17	Q9UM47	2.02e-39	148	2321	0.307	0.036	NOTC3_HUMAN Neurogenic locus notch homolog protein 3 OS=Homo sapiens OX=9606 GN=NOTCH3 PE=1 SV=2
18	Q99466	2.83e-39	147	2003	0.372	0.051	NOTC4_HUMAN Neurogenic locus notch homolog protein 4 OS=Homo sapiens OX=9606 GN=NOTCH4 PE=1 SV=2
19	P31695	3.20e-39	147	1964	0.358	0.050	NOTC4_MOUSE Neurogenic locus notch homolog protein 4 OS=Mus musculus OX=10090 GN=Notch4 PE=1 SV=3
20	Q800E4	3.86e-39	147	2468	0.292	0.032	Q800E4_DANRE Neurogenic locus notch homolog protein 3 precursor OS=Danio rerio OX=7955 GN=fa14b08 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12662 cEGF	1.4e+02	13.8	Complement Clr-like EGF-like
2	PF00008 EGF	7.2e-29	111.0	EGF-like domain
3	PF07974 EGF_2	9.8e-07	40.4	EGF-like domain
4	PF12947 EGF_3	0.00026	32.4	EGF domain
5	PF07645 EGF_CA	8e-06	37.3	Calcium-binding EGF domain
6	PF14670 FXa_inhibition	3.6e+02	12.9	Coagulation Factor Xa inhibitory site
7	PF12661 hEGF	1.7e-15	68.2	Human growth factor-like EGF
8	PF00053 Laminin_EGF	6.1e+02	12.0	Laminin EGF domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000001116

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000016373	0.982	Transcriptional regulator that plays a central role in Notch signaling, a signaling pathway involved in cell-cell communication that regulates a broad spectrum of cell-fate determinations. Acts as a transcriptional repressor when it is not associated with Notch proteins. When associated with some NICD product of Notch proteins (Notch intracellular domain), it acts as a transcriptional activator that activates transcription of Notch target genes. Probably represses or activates transcription via the recruitment of chromatin remodeling complexes containing histone deacetylase or histone [...]
2	9601.ENSPPYP00000018042	0.980	Mastermind-like 1 (Drosophila)
3	9601.ENSPPYP00000011973	0.974	Delta-like protein
4	9601.ENSPPYP00000019254	0.963	Delta-like protein
5	9601.ENSPPYP00000024574	0.963	Delta-like protein
6	9601.ENSPPYP00000009839	0.959	Beta-1,3-N-acetylglucosaminyltransferase
7	9601.ENSPPYP00000011192	0.952	NUMB like, endocytic adaptor protein
8	9601.ENSPPYP00000010835	0.941	Notch 3
9	9601.ENSPPYP00000018437	0.940	Notch 4
10	9601.ENSPPYP00000014138	0.936	ADAM metallopeptidase domain 17
11	9601.ENSPPYP00000000736	0.922	Nicastrin precursor
12	9601.ENSPPYP00000008887	0.920	Dishevelled segment polarity protein 2
13	9601.ENSPPYP00000016042	0.920	Dishevelled segment polarity protein 3
14	9601.ENSPPYP00000022269	0.916	Uncharacterized protein
15	9601.ENSPPYP00000004339	0.914	Mastermind-like 2 (Drosophila)
16	9601.ENSPPYP00000005682	0.913	Deltex 1, E3 ubiquitin ligase
17	9601.ENSPPYP00000000158	0.912	Probable catalytic subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins such as Notch receptors and APP (amyloid- beta precursor protein). Requires the other members of the gamma- secretase complex to have a protease activity. May play a role in intracellular signaling and gene expression or in linking chromatin to the nuclear membrane. May function in the cytoplasmic partitioning of proteins. The holoprotein functions as a calcium-leak channel that allows the passive movement of calcium from endoplasmic [...]
18	9601.ENSPPYP00000006781	0.912	Catalytic subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins such as Notch receptors and APP (amyloid- beta precursor protein). Requires the presence of the other members of the gamma-secretase complex for protease activity. Plays a role in Notch and Wnt signaling cascades and regulation of downstream processes via its role in processing key regulatory proteins, and by regulating cytosolic CTNNB1 levels. Stimulates cell-cell adhesion via its interaction with CDH1
19	9601.ENSPPYP00000011163	0.912	Delta-like 3 (Drosophila)
20	9601.ENSPPYP00000001058	0.905	Aph-1 homolog A, gamma-secretase subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005112	0.999	Notch binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0008593	0.972	regulation of Notch signaling pathway
GO:0032502	0.967	developmental process
GO:0021543	0.913	pallium development
GO:0023056	0.780	positive regulation of signaling
GO:0010647	0.780	positive regulation of cell communication
GO:0045747	0.772	positive regulation of Notch signaling pathway
GO:0021987	0.759	cerebral cortex development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0016020	0.852	membrane
GO:0005622	0.852	intracellular anatomical structure
GO:0043226	0.807	organelle
GO:0043227	0.607	membrane-bounded organelle
GO:0005737	0.572	cytoplasm
GO:0043229	0.546	intracellular organelle
GO:0071944	0.382	cell periphery
GO:0005886	0.363	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]