StarFunc result for job id A0A096LP49

User Input

>input (1063 residues)
MPTLVVGTPPTCLGDTPQPCHKNSQRQGPFSHGAPGRAADWKAVAKPRLCAPAAEDDVAA
LRWPGPSQQPDPPWAAPHVVGSDDLKEPGPWGKACSLPMWSTGPEARDGDSSVSSGRLSC
SSGGHDVCVSWKERPPQVLGPQQRPRKSDARLEQLRDKIRAQAWQQGSCASLGTSAPSSA
SRLHKASTLMLRRKGQEAKNPPPAPECSGFSILSAAERRVEAKASHGQGRELSRVSQHQV
PVLREKPKRVKSSSCKREKTPKLPSPRRAAKDKHKDEDSELVGVYAWRKGQALVRSLLGP
PPVLRRHHSKDPSRDPALTVDLGDSEKVIAAKCSPVCAQLPDATSAYSDQQVSGNTPSLA
SFDQPATIQTAMAILQDLRQQIQAGLELAQARKGGQELGPSKRRLQDVAGRGCCRDPNAQ
SSFSKSPWAMTERKHSSLERARSVHTWEPWSSSTARESCPQRAWGAQGQDRSFQRPESPH
ERLGHFSQRPWSALAGQACSPQRAWGAQRQGPSSQRPGSPPEKRSPFPQQPWSAVATQPC
PRRAWTACETWEDPGPRLRNPLERPSPPAQRPWSSSGVQRAGPQGKGRGIGSPVSAAKHA
LPRPTGSFPQNPLGKEKDTLRPCPRSRGLLGPSHSSESLREFMRQKAQARRRQALEEKAS
ALRTRELRSRRLQEVYRQQREAVLGRAVPVVSRTTPGIVTFVPSSAQSGGLEASGSLESP
VLEWSKVTSGMVLGGQEAPGSFCLCLNRAWNHAETLDPPGMGGPQDGRDAPVLLSASPSL
GSLELQDLTTRYLPRGMCIYLDPKEAEHLGTSSSLHLRHKQAQLQALETTAKVLKQRVDS
LTAKLQGAEALDTVRDPAVGLLRSCPHSLPAAPTLATPTLATPACPGALGPNWGRGAPGE
WVSMQPQPLLPPTYFLDGETLSWGPSWEQQQSVSPRAHCESKPRGFPEEGHVDVKPDKRL
QRGVAPFQALSPSAGSSYAGPATLHPIWGSLGLEETPSVGGADSVAPCTPRSCGKGDPAD
RPWAGWSGGRGIHREHLPLPSTRAWPYGVEKSFSTWRASTPRY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IVT4	0.118	0.126	0.000	953	0.884	0.986	Q8IVT4.pdb.gz	Q8IVT4_HUMAN Hypothetical MGC50722 OS=Homo sapiens OX=9606 GN=MGC50722 PE=1 SV=1
2	AFDB:Q9W705	0.057	0.044	1.310E-4	1516	0.163	0.114	Q9W705.pdb.gz	NCOA2_XENLA Nuclear receptor coactivator 2 OS=Xenopus laevis OX=8355 GN=ncoa2 PE=2 SV=1
3	AFDB:Q9WUI9	0.053	0.042	4.644E-4	1465	0.155	0.113	Q9WUI9.pdb.gz	NCOA2_RAT Nuclear receptor coactivator 2 OS=Rattus norvegicus OX=10116 GN=Ncoa2 PE=1 SV=1
4	AFDB:E9PFQ4	0.037	0.035	7.127E-3	1115	0.140	0.134	E9PFQ4.pdb.gz	E9PFQ4_HUMAN Pleckstrin homology like domain family B member 2 (Fragment) OS=Homo sapiens OX=9606 GN=PHLDB2 PE=1 SV=1
5	AFDB:Q9U263	0.048	0.034	9.303E-3	1645	0.173	0.112	Q9U263.pdb.gz	SET26_CAEEL Histone-lysine N-methyltransferase set-26 OS=Caenorhabditis elegans OX=6239 GN=set-26 PE=1 SV=3
6	AFDB:M9NEB2	0.047	0.041	1.063E-2	1273	0.120	0.101	M9NEB2.pdb.gz	M9NEB2_DROME Myosin binding subunit, isoform O OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1
7	AFDB:A5PL33	0.050	0.052	1.694E-2	1030	0.186	0.192	A5PL33.pdb.gz	KRBA1_HUMAN Protein KRBA1 OS=Homo sapiens OX=9606 GN=KRBA1 PE=1 SV=3
8	AFDB:O44498	0.049	0.038	1.936E-2	1623	0.188	0.123	O44498.pdb.gz	SET9_CAEEL Histone-lysine N-methyltransferase set-9 OS=Caenorhabditis elegans OX=6239 GN=set-9 PE=1 SV=2
9	AFDB:Q9VWC6	0.061	0.043	6.420E-2	1596	0.169	0.113	Q9VWC6.pdb.gz	Q9VWC6_DROME FI17950p1 OS=Drosophila melanogaster OX=7227 GN=zld PE=2 SV=1
10	AFDB:Q9Y6A5	0.042	0.053	7.335E-2	838	0.117	0.148	Q9Y6A5.pdb.gz	TACC3_HUMAN Transforming acidic coiled-coil-containing protein 3 OS=Homo sapiens OX=9606 GN=TACC3 PE=1 SV=1
11	PDB:5l3cB	0.048	0.303	6.423	134	0.018	0.142	5l3cB.pdb.gz	LSD1/KDM1A mutations associated to a newly described form of intellectual disability impair demethylase activity and binding to transcription factors.
12	PDB:7emfO	0.023	0.126	7.844	157	0.005	0.032	7emfO.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8IVT4	0.0	1862	953	0.884	0.986	Q8IVT4_HUMAN Hypothetical MGC50722 OS=Homo sapiens OX=9606 GN=MGC50722 PE=1 SV=1
2	E9Q309	0.024	41.2	3095	0.043	0.015	CE350_MOUSE Centrosome-associated protein 350 OS=Mus musculus OX=10090 GN=Cep350 PE=1 SV=1
3	Q5VT06	0.058	40.0	3117	0.015	0.005	CE350_HUMAN Centrosome-associated protein 350 OS=Homo sapiens OX=9606 GN=CEP350 PE=1 SV=1
4	O76934	0.23	38.1	902	0.025	0.030	O76934_DROME Iron regulatory protein-1A OS=Drosophila melanogaster OX=7227 GN=Irp-1A PE=2 SV=1
5	Q9NFX3	0.32	37.4	902	0.025	0.030	Q9NFX3_DROME Iron regulatory protein 1A OS=Drosophila melanogaster OX=7227 GN=Irp-1A PE=2 SV=1
6	Q9VCV4	0.33	37.4	902	0.025	0.030	Q9VCV4_DROME Iron regulatory protein 1A OS=Drosophila melanogaster OX=7227 GN=Irp-1A PE=1 SV=1
7	Q388S9	1.2	35.8	1236	0.026	0.023	Q388S9_TRYB2 Nrap protein domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.389.0280 PE=3 SV=1
8	Q9W148	3.1	34.3	731	0.022	0.031	URI_DROME Unconventional prefoldin RPB5 interactor-like protein OS=Drosophila melanogaster OX=7227 GN=uri PE=1 SV=1
9	Q58G59	4.6	33.9	1363	0.038	0.029	KIF7_DANRE Kinesin-like protein kif7 OS=Danio rerio OX=7955 GN=kif7 PE=1 SV=1
10	P40354	9.3	32.3	457	0.023	0.053	NTA1_YEAST Protein N-terminal amidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NTA1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008968314.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008960960.1	0.750	Dynactin subunit 1 isoform X1
2	9597.XP_003824906.1	0.733	Dynactin subunit 2 isoform X1
3	9597.XP_003809329.1	0.681	Positively regulates the activity of the minus-end directed microtubule motor protein dynein. May enhance dynein-mediated microtubule sliding by targeting dynein to the microtubule plus end. Required for several dynein- and microtubule-dependent processes such as the maintenance of Golgi integrity, the peripheral transport of microtubule fragments and the coupling of the nucleus and centrosome. Required during brain development for the proliferation of neuronal precursors and the migration of newly formed neurons from the ventricular/subventricular zone toward the cortical plate. Neuro [...]
4	9597.XP_003812558.1	0.681	Sperm associated antigen 16
5	9597.XP_003820535.1	0.681	TBC1 domain family member 31 isoform X1
6	9597.XP_003829855.1	0.675	Dynactin subunit 3
7	9597.XP_003830818.1	0.648	Dynactin subunit 6
8	9597.XP_008966376.1	0.587	Cytoskeleton associated protein 5
9	9597.XP_003829058.1	0.581	Dynactin subunit 4 isoform X1
10	9597.XP_003814782.1	0.568	Microtubule-associated protein RP/EB family member 1
11	9597.XP_003830288.1	0.568	Microtubule-associated protein RP/EB family member 2 isoform X1
12	9597.XP_008950680.1	0.568	Microtubule-associated protein RP/EB family member 3 isoform X1
13	9597.XP_008971467.1	0.517	CYLD lysine 63 deubiquitinase
14	9597.XP_003807119.1	0.511	Cytoplasmic dynein 1 heavy chain 1
15	9597.XP_003810112.1	0.511	Dynein heavy chain 2, axonemal
16	9597.XP_003812124.1	0.511	Dynein axonemal heavy chain 3
17	9597.XP_003816643.1	0.511	Dynein axonemal heavy chain 6
18	9597.XP_003818154.1	0.511	Dynein axonemal heavy chain 9
19	9597.XP_003818926.1	0.511	Dynein axonemal heavy chain 8
20	9597.XP_003821994.1	0.511	Dynein heavy chain 5, axonemal isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.961	cellular process
GO:0050789	0.824	regulation of biological process
GO:0071840	0.789	cellular component organization or biogenesis
GO:0016043	0.751	cellular component organization
GO:0044085	0.489	cellular component biogenesis
GO:0050794	0.434	regulation of cellular process
GO:0022607	0.434	cellular component assembly
GO:0051179	0.427	localization
GO:0006996	0.300	organelle organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.997	cytoplasm
GO:0015630	0.997	microtubule cytoskeleton
GO:0005815	0.986	microtubule organizing center
GO:0005874	0.935	microtubule
GO:0043231	0.724	intracellular membrane-bounded organelle
GO:0005813	0.709	centrosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]