StarFunc result for job id A0A096LPK6

User Input

>input (155 residues)
VEEWGPFDLVYGATPPLGHTCDRPPSWYLFQFHRLLQYARPKPGSPRPFFWMFVDNLVLN
KEDLDVASRFLEMEPVTIPDVHGGSLQNAVRVWSNIPAIRSRHWALVSEEELSLLAQNKQ
SSKLAAKWPTKLVKNCFLPLREYFKYFSTELTSSL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UJW3	0.978	0.396	2.957E-31	386	0.994	0.399	Q9UJW3.pdb.gz	DNM3L_HUMAN DNA (cytosine-5)-methyltransferase 3-like OS=Homo sapiens OX=9606 GN=DNMT3L PE=1 SV=3
2	PDB:2pv0B	0.928	0.420	1.339E-27	347	0.948	0.424	2pv0B.pdb.gz	DNMT3L connects unmethylated lysine 4 of histone H3 to de novo methylation of DNA.
3	AFDB:Q9CWR8	0.848	0.327	1.516E-20	421	0.568	0.209	Q9CWR8.pdb.gz	DNM3L_MOUSE DNA (cytosine-5)-methyltransferase 3-like OS=Mus musculus OX=10090 GN=Dnmt3l PE=1 SV=1
4	AFDB:Q1LZ50	0.846	0.327	5.288E-20	422	0.587	0.216	Q1LZ50.pdb.gz	DNM3L_RAT DNA (cytosine-5)-methyltransferase 3-like OS=Rattus norvegicus OX=10116 GN=Dnmt3l PE=2 SV=1
5	AFDB:O88509	0.629	0.127	1.010E-8	859	0.348	0.063	O88509.pdb.gz	DNM3B_MOUSE DNA (cytosine-5)-methyltransferase 3B OS=Mus musculus OX=10090 GN=Dnmt3b PE=1 SV=2
6	AFDB:A0A0G2JYR2	0.540	0.125	1.152E-8	731	0.252	0.053	A0A0G2JYR2.pdb.gz	A0A0G2JYR2_RAT DNA (cytosine-5-)-methyltransferase OS=Rattus norvegicus OX=10116 GN=Dnmt3b PE=3 SV=2
7	AFDB:Q08CT6	0.627	0.133	1.950E-8	816	0.329	0.062	Q08CT6.pdb.gz
8	AFDB:Q9Y6K1	0.629	0.119	4.584E-8	912	0.335	0.057	Q9Y6K1.pdb.gz	DNM3A_HUMAN DNA (cytosine-5)-methyltransferase 3A OS=Homo sapiens OX=9606 GN=DNMT3A PE=1 SV=4
9	AFDB:Q4W5Z4	0.632	0.123	4.896E-8	877	0.335	0.059	Q4W5Z4.pdb.gz	DNM3A_CHICK DNA (cytosine-5)-methyltransferase 3A OS=Gallus gallus OX=9031 GN=DNMT3A PE=2 SV=1
10	AFDB:Q9UBC3	0.627	0.129	5.229E-8	853	0.335	0.061	Q9UBC3.pdb.gz	DNM3B_HUMAN DNA (cytosine-5)-methyltransferase 3B OS=Homo sapiens OX=9606 GN=DNMT3B PE=1 SV=1
11	PDB:6pa7N	0.639	0.482	6.372E-8	211	0.303	0.223	6pa7N.pdb.gz	Structure of nucleosome-bound DNA methyltransferases DNMT3A and DNMT3B.
12	AFDB:P0DOY1	0.623	0.144	7.264E-8	740	0.310	0.065	P0DOY1.pdb.gz	DNM3C_MOUSE DNA (cytosine-5)-methyltransferase 3C OS=Mus musculus OX=10090 GN=Dnmt3c PE=1 SV=2
13	PDB:7pubIB	0.325	0.137	5.932E-2	511	0.110	0.033	7pubIB.pdb.gz	Mitoribosomal small subunit maturation involves formation of initiation-like complexes.
14	PDB:1je3A	0.252	0.341	1.004E-1	97	0.065	0.103	1je3A.pdb.gz
15	PDB:3a4tA	0.318	0.208	1.145E-1	258	0.065	0.039	3a4tA.pdb.gz	Crystal structure of Methanocaldococcus jannaschii Trm4 complexed with sinefungin.
16	PDB:1qzzA	0.280	0.154	1.490E-1	340	0.077	0.035	1qzzA.pdb.gz	Crystal Structure of Aclacinomycin-10-Hydroxylase, a S-Adenosyl-L-Methionine-dependent Methyltransferase Homolog Involved in Anthracycline Biosynthesis in Streptomyces purpurascens.
17	PDB:2o06A	0.304	0.183	1.591E-1	297	0.110	0.057	2o06A.pdb.gz	Structure and mechanism of spermidine synthases.
18	PDB:1dcjA	0.233	0.378	1.814E-1	81	0.052	0.099	1dcjA.pdb.gz
19	PDB:3crlB	0.149	0.085	1.938E-1	383	0.110	0.044	3crlB.pdb.gz	Structural and functional insights into the molecular mechanisms responsible for the regulation of pyruvate dehydrogenase kinase 2.
20	PDB:6y4gB	0.350	0.240	2.210E-1	246	0.103	0.065	6y4gB.pdb.gz	Small-Molecule Inhibitors of METTL3, the Major Human Epitranscriptomic Writer.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UJW3	3.51e-112	325	386	1.000	0.402	DNM3L_HUMAN DNA (cytosine-5)-methyltransferase 3-like OS=Homo sapiens OX=9606 GN=DNMT3L PE=1 SV=3
2	Q1LZ50	3.38e-63	201	422	0.594	0.218	DNM3L_RAT DNA (cytosine-5)-methyltransferase 3-like OS=Rattus norvegicus OX=10116 GN=Dnmt3l PE=2 SV=1
3	Q9CWR8	1.35e-60	194	421	0.581	0.214	DNM3L_MOUSE DNA (cytosine-5)-methyltransferase 3-like OS=Mus musculus OX=10090 GN=Dnmt3l PE=1 SV=1
4	A0A0G2JYR2	5.12e-21	90.5	796	0.310	0.060	A0A0G2JYR2_RAT DNA (cytosine-5-)-methyltransferase OS=Rattus norvegicus OX=10116 GN=Dnmt3b PE=3 SV=2
5	Q9UBC3	2.86e-17	79.7	853	0.265	0.048	DNM3B_HUMAN DNA (cytosine-5)-methyltransferase 3B OS=Homo sapiens OX=9606 GN=DNMT3B PE=1 SV=1
6	Q1LZ51	1.43e-16	77.8	859	0.258	0.047	Q1LZ51_RAT DNA (cytosine-5-)-methyltransferase OS=Rattus norvegicus OX=10116 GN=Dnmt3b PE=2 SV=1
7	O88509	1.45e-16	77.8	859	0.258	0.047	DNM3B_MOUSE DNA (cytosine-5)-methyltransferase 3B OS=Mus musculus OX=10090 GN=Dnmt3b PE=1 SV=2
8	A0A8J8XG14	1.50e-16	77.8	860	0.258	0.047	A0A8J8XG14_RAT DNA (cytosine-5-)-methyltransferase OS=Rattus norvegicus OX=10116 GN=Dnmt3b PE=3 SV=1
9	A0A8I6AVL3	1.65e-16	77.4	839	0.258	0.048	A0A8I6AVL3_RAT DNA (cytosine-5-)-methyltransferase OS=Rattus norvegicus OX=10116 GN=Dnmt3b PE=3 SV=1
10	Q588C6	1.87e-16	77.4	816	0.258	0.049	Q588C6_DANRE DNA (cytosine-5-)-methyltransferase OS=Danio rerio OX=7955 GN=cb633 PE=1 SV=1
11	P0DOY1	3.95e-16	76.6	740	0.258	0.054	DNM3C_MOUSE DNA (cytosine-5)-methyltransferase 3C OS=Mus musculus OX=10090 GN=Dnmt3c PE=1 SV=2
12	Q4W5Z4	9.71e-16	75.5	877	0.290	0.051	DNM3A_CHICK DNA (cytosine-5)-methyltransferase 3A OS=Gallus gallus OX=9031 GN=DNMT3A PE=2 SV=1
13	Q1LZ53	1.13e-15	75.1	908	0.290	0.050	DNM3A_RAT DNA (cytosine-5)-methyltransferase 3A OS=Rattus norvegicus OX=10116 GN=Dnmt3a PE=1 SV=1
14	O88508	1.26e-15	75.1	908	0.290	0.050	DNM3A_MOUSE DNA (cytosine-5)-methyltransferase 3A OS=Mus musculus OX=10090 GN=Dnmt3a PE=1 SV=2
15	Q9Y6K1	1.48e-15	74.7	912	0.290	0.049	DNM3A_HUMAN DNA (cytosine-5)-methyltransferase 3A OS=Homo sapiens OX=9606 GN=DNMT3A PE=1 SV=4
16	A0A2R9YJL5	6.18e-13	67.4	1456	0.232	0.025	A0A2R9YJL5_DANRE DNA (cytosine-5-)-methyltransferase OS=Danio rerio OX=7955 GN=cb91 PE=1 SV=1
17	B0S581	6.67e-13	67.4	1433	0.232	0.025	B0S581_DANRE DNA (cytosine-5-)-methyltransferase OS=Danio rerio OX=7955 GN=cb91 PE=1 SV=1
18	Q588C7	6.29e-12	64.3	1448	0.226	0.024	Q588C7_DANRE DNA (cytosine-5-)-methyltransferase OS=Danio rerio OX=7955 GN=dnmt3 PE=1 SV=1
19	Q8R0W0	0.21	33.9	6548	0.161	0.004	EPIPL_MOUSE Epiplakin OS=Mus musculus OX=10090 GN=Eppk1 PE=1 SV=2
20	A0A509AQU3	1.9	30.8	362	0.116	0.050	SHLP1_PLABA Shewanella-like protein phosphatase 1 OS=Plasmodium berghei (strain Anka) OX=5823 GN=SHLP1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000485664

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264709	0.510	DNA (cytosine-5)-methyltransferase 3A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140677	0.999	molecular function activator activity
GO:0030234	0.999	enzyme regulator activity
GO:0005515	0.999	protein binding
GO:0008047	0.994	enzyme activator activity
GO:0019899	0.570	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.996	primary metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0043170	0.995	macromolecule metabolic process
GO:0090304	0.986	nucleic acid metabolic process
GO:0050794	0.979	regulation of cellular process
GO:0060255	0.977	regulation of macromolecule metabolic process
GO:0006306	0.975	DNA methylation
GO:0032776	0.963	DNA methylation on cytosine
GO:0048519	0.958	negative regulation of biological process
GO:0010468	0.958	regulation of gene expression
GO:0019219	0.958	regulation of nucleobase-containing compound metabolic process
GO:0009892	0.935	negative regulation of metabolic process
GO:0010605	0.929	negative regulation of macromolecule metabolic process
GO:0010556	0.785	regulation of macromolecule biosynthetic process
GO:0048523	0.781	negative regulation of cellular process
GO:0051172	0.780	negative regulation of nitrogen compound metabolic process
GO:0071840	0.760	cellular component organization or biogenesis
GO:0045934	0.730	negative regulation of nucleobase-containing compound metabolic process
GO:0016043	0.724	cellular component organization
GO:0051252	0.660	regulation of RNA metabolic process
GO:0031326	0.659	regulation of cellular biosynthetic process
GO:2001141	0.614	regulation of RNA biosynthetic process
GO:0031327	0.582	negative regulation of cellular biosynthetic process
GO:1903506	0.569	regulation of nucleic acid-templated transcription
GO:0051253	0.558	negative regulation of RNA metabolic process
GO:0006355	0.556	regulation of DNA-templated transcription
GO:0010558	0.543	negative regulation of macromolecule biosynthetic process
GO:1902679	0.531	negative regulation of RNA biosynthetic process
GO:0050896	0.495	response to stimulus
GO:0090116	0.493	C-5 methylation of cytosine
GO:0045892	0.465	negative regulation of DNA-templated transcription
GO:0040029	0.396	epigenetic regulation of gene expression
GO:0045471	0.361	response to ethanol
GO:0048518	0.330	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005634	0.999	nucleus
GO:1902494	0.995	catalytic complex
GO:0005654	0.966	nucleoplasm
GO:0043232	0.940	intracellular non-membrane-bounded organelle
GO:0005694	0.893	chromosome
GO:0005829	0.632	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]