StarFunc result for job id A0A0B4J1U7

User Input

>input (121 residues)
MSVSFLIFLPVLGLPWGVLSQVQLQQSGPGLVKPSQTLSLTCAISGDSVSSNSAAWNWIR
QSPSRGLEWLGRTYYRSKWYNDYAVSVKSRITINPDTSKNQFSLQLNSVTPEDTAVYYCA
R

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P01824	0.805	0.781	2.786E-14	125	0.595	0.576	P01824.pdb.gz	HV439_HUMAN Immunoglobulin heavy variable 4-39 OS=Homo sapiens OX=9606 GN=IGHV4-39 PE=1 SV=2
2	AFDB:P18531	0.824	0.859	1.051E-13	116	0.587	0.612	P18531.pdb.gz	HVM60_MOUSE Ig heavy chain V region 3-6 OS=Mus musculus OX=10090 GN=Ighv3-6 PE=1 SV=1
3	AFDB:P06331	0.783	0.771	4.649E-13	123	0.554	0.545	P06331.pdb.gz	HV434_HUMAN Immunoglobulin heavy variable 4-34 OS=Homo sapiens OX=9606 GN=IGHV4-34 PE=1 SV=2
4	AFDB:P01814	0.804	0.817	1.418E-12	119	0.463	0.471	P01814.pdb.gz	HV270_HUMAN Immunoglobulin heavy variable 2-70 OS=Homo sapiens OX=9606 GN=IGHV2-70 PE=1 SV=2
5	AFDB:P01817	0.833	0.846	9.098E-12	119	0.471	0.479	P01817.pdb.gz	HV205_HUMAN Immunoglobulin heavy variable 2-5 OS=Homo sapiens OX=9606 GN=IGHV2-5 PE=1 SV=2
6	AFDB:P01762	0.755	0.779	1.012E-11	117	0.463	0.479	P01762.pdb.gz	HV311_HUMAN Immunoglobulin heavy variable 3-11 OS=Homo sapiens OX=9606 GN=IGHV3-11 PE=1 SV=2
7	AFDB:P01764	0.763	0.787	2.018E-11	117	0.463	0.479	P01764.pdb.gz	HV323_HUMAN Immunoglobulin heavy variable 3-23 OS=Homo sapiens OX=9606 GN=IGHV3-23 PE=1 SV=2
8	AFDB:P01743	0.803	0.829	3.432E-11	117	0.388	0.402	P01743.pdb.gz	HV146_HUMAN Immunoglobulin heavy variable 1-46 OS=Homo sapiens OX=9606 GN=IGHV1-46 PE=1 SV=2
9	AFDB:P01768	0.737	0.761	5.837E-11	117	0.446	0.462	P01768.pdb.gz	HV330_HUMAN Immunoglobulin heavy variable 3-30 OS=Homo sapiens OX=9606 GN=IGHV3-30 PE=1 SV=2
10	AFDB:P01742	0.776	0.801	1.295E-10	117	0.413	0.427	P01742.pdb.gz	HV169_HUMAN Immunoglobulin heavy variable 1-69 OS=Homo sapiens OX=9606 GN=IGHV1-69 PE=1 SV=2
11	PDB:1ezvX	0.776	0.740	1.322E-10	127	0.471	0.449	1ezvX.pdb.gz	Structure at 2.3 A resolution of the cytochrome bc(1) complex from the yeast Saccharomyces cerevisiae co-crystallized with an antibody Fv fragment.
12	PDB:3upcA	0.732	0.780	5.544E-10	113	0.397	0.425	3upcA.pdb.gz
13	PDB:6rulA	0.738	0.334	1.297E-9	276	0.372	0.163	6rulA.pdb.gz	Chemogenetic Control of Nanobodies.
14	PDB:1ohqA	0.748	0.754	3.955E-9	120	0.413	0.417	1ohqA.pdb.gz
15	PDB:1zvoC	0.754	0.187	5.158E-9	512	0.471	0.111	1zvoC.pdb.gz
16	PDB:5c6wJ	0.740	0.387	9.756E-9	238	0.355	0.181	5c6wJ.pdb.gz
17	PDB:7czpH	0.743	0.416	9.756E-9	222	0.554	0.302	7czpH.pdb.gz
18	PDB:3zhlA	0.736	0.736	1.029E-8	121	0.413	0.413	3zhlA.pdb.gz
19	PDB:4pfeA	0.742	0.273	1.845E-8	342	0.372	0.132	4pfeA.pdb.gz
20	PDB:7fabH	0.766	0.450	1.845E-8	209	0.479	0.278	7fabH.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P01825	3.78e-43	139	116	0.603	0.629	HV459_HUMAN Immunoglobulin heavy variable 4-59 OS=Homo sapiens OX=9606 GN=IGHV4-59 PE=1 SV=2
2	P01824	3.34e-40	132	125	0.612	0.592	HV439_HUMAN Immunoglobulin heavy variable 4-39 OS=Homo sapiens OX=9606 GN=IGHV4-39 PE=1 SV=2
3	P18531	1.21e-39	130	116	0.587	0.612	HVM60_MOUSE Ig heavy chain V region 3-6 OS=Mus musculus OX=10090 GN=Ighv3-6 PE=1 SV=1
4	P06331	5.93e-38	126	123	0.562	0.553	HV434_HUMAN Immunoglobulin heavy variable 4-34 OS=Homo sapiens OX=9606 GN=IGHV4-34 PE=1 SV=2
5	P01814	7.70e-33	113	119	0.479	0.487	HV270_HUMAN Immunoglobulin heavy variable 2-70 OS=Homo sapiens OX=9606 GN=IGHV2-70 PE=1 SV=2
6	P0DOX3	4.25e-32	119	512	0.471	0.111	IGD_HUMAN Immunoglobulin delta heavy chain OS=Homo sapiens OX=9606 PE=1 SV=1
7	P01817	2.04e-31	109	119	0.471	0.479	HV205_HUMAN Immunoglobulin heavy variable 2-5 OS=Homo sapiens OX=9606 GN=IGHV2-5 PE=1 SV=2
8	P01767	2.16e-29	104	116	0.455	0.474	HV353_HUMAN Immunoglobulin heavy variable 3-53 OS=Homo sapiens OX=9606 GN=IGHV3-53 PE=1 SV=2
9	P01772	5.31e-29	103	117	0.479	0.496	HV333_HUMAN Immunoglobulin heavy variable 3-33 OS=Homo sapiens OX=9606 GN=IGHV3-33 PE=1 SV=2
10	P01763	2.61e-28	101	117	0.496	0.513	HV348_HUMAN Immunoglobulin heavy variable 3-48 OS=Homo sapiens OX=9606 GN=IGHV3-48 PE=1 SV=2
11	P01768	3.01e-28	101	117	0.471	0.487	HV330_HUMAN Immunoglobulin heavy variable 3-30 OS=Homo sapiens OX=9606 GN=IGHV3-30 PE=1 SV=2
12	P01762	9.99e-28	100	117	0.488	0.504	HV311_HUMAN Immunoglobulin heavy variable 3-11 OS=Homo sapiens OX=9606 GN=IGHV3-11 PE=1 SV=2
13	P01764	1.53e-27	99.8	117	0.488	0.504	HV323_HUMAN Immunoglobulin heavy variable 3-23 OS=Homo sapiens OX=9606 GN=IGHV3-23 PE=1 SV=2
14	P01782	4.62e-27	98.6	118	0.438	0.449	HV309_HUMAN Immunoglobulin heavy variable 3-9 OS=Homo sapiens OX=9606 GN=IGHV3-9 PE=1 SV=2
15	P01780	1.48e-26	97.4	117	0.479	0.496	HV307_HUMAN Immunoglobulin heavy variable 3-7 OS=Homo sapiens OX=9606 GN=IGHV3-7 PE=1 SV=2
16	A2KUC3	6.30e-26	95.9	121	0.446	0.446	A2KUC3_HUMAN UGa8H (Fragment) OS=Homo sapiens OX=9606 GN=IGHV PE=4 SV=1
17	P01766	1.07e-23	90.1	116	0.438	0.457	HV313_HUMAN Immunoglobulin heavy variable 3-13 OS=Homo sapiens OX=9606 GN=IGHV3-13 PE=1 SV=2
18	P01742	1.11e-22	87.4	117	0.413	0.427	HV169_HUMAN Immunoglobulin heavy variable 1-69 OS=Homo sapiens OX=9606 GN=IGHV1-69 PE=1 SV=2
19	P06328	2.96e-22	86.3	117	0.421	0.436	HVM49_MOUSE Ig heavy chain V region 1-72 OS=Mus musculus OX=10090 GN=Ighv1-72 PE=1 SV=2
20	P01743	3.37e-20	80.9	117	0.372	0.385	HV146_HUMAN Immunoglobulin heavy variable 1-46 OS=Homo sapiens OX=9606 GN=IGHV1-46 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07679 I-set	41	15.7	Immunoglobulin I-set domain
2	PF00047 ig	0.46	22.0	Immunoglobulin domain
3	PF13895 Ig_2	8	18.2	Immunoglobulin domain
4	PF13927 Ig_3	0.073	25.0	Immunoglobulin domain
5	PF07686 V-set	3.1e-09	48.4	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9555.ENSPANP00000013395

Rank	PPI partner	STRING score	Description
1	9555.ENSPANP00000004132	0.736	Polymeric immunoglobulin receptor
2	9555.ENSPANP00000019398	0.588	Spleen tyrosine kinase
3	9555.ENSPANP00000004416	0.572	LYN proto-oncogene, Src family tyrosine kinase
4	9555.ENSPANP00000010241	0.571	Phospholipase C, gamma 2 (phosphatidylinositol-specific)
5	9555.ENSPANP00000012177	0.536	Zeta-chain (TCR) associated protein kinase 70kDa
6	9555.ENSPANP00000003013	0.535	Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor. Binds IgG1 and IgG2 (By similarity).
7	9555.ENSPANP00000017732	0.527	Mediates the production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3). Plays an important role in the regulation of intracellular signaling cascades.
8	9555.ENSPANP00000017592	0.525	Receptor for the thyroid-stimulating hormone (TSH) or thyrotropin. Also acts as a receptor for the heterodimeric glycoprotein hormone (GPHA2:GPHB5) or thyrostimulin. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. Plays a central role in controlling thyroid cell metabolism.
9	9555.ENSPANP00000003878	0.502	Receptor protein-tyrosine kinase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0038023	0.311	signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.999	response to stimulus
GO:0009607	0.988	response to biotic stimulus
GO:0043207	0.979	response to external biotic stimulus
GO:0044419	0.975	biological process involved in interspecies interaction between organisms
GO:0051707	0.922	response to other organism
GO:0009617	0.751	response to bacterium
GO:0009987	0.735	cellular process
GO:0051716	0.311	cellular response to stimulus
GO:0032501	0.309	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.996	extracellular region
GO:0005886	0.996	plasma membrane
GO:0005829	0.523	cytosol
GO:0032991	0.379	protein-containing complex
GO:0043231	0.379	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]