StarFunc result for job id A0A0B4J2F0

User Input

>input (54 residues)
MFRRLTFAQLLFATVLGIAGGVYIFQPVFEQYAKDQKELKEKMQLVQESEEKKS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0B4J2F0	1.000	1.000	4.081E-7	54	1.000	1.000	A0A0B4J2F0.pdb.gz	PIOS1_HUMAN Protein PIGBOS1 OS=Homo sapiens OX=9606 GN=PIGBOS1 PE=1 SV=1
2	AFDB:C0HLN0	0.943	0.943	4.511E-5	54	0.704	0.704	C0HLN0.pdb.gz	PIOS1_RAT Protein PIGBOS1 OS=Rattus norvegicus OX=10116 GN=Pigbos1 PE=1 SV=1
3	AFDB:Q8BGV3	0.533	0.127	5.120	317	0.185	0.032	Q8BGV3.pdb.gz	TACD2_MOUSE Tumor-associated calcium signal transducer 2 OS=Mus musculus OX=10090 GN=Tacstd2 PE=1 SV=1
4	AFDB:B8JM11	0.431	0.117	8.401	303	0.167	0.030	B8JM11.pdb.gz
5	AFDB:Q9VFE5	0.349	0.108	9.124	212	0.167	0.042	Q9VFE5.pdb.gz	Q9VFE5_DROME Vacuolar H[+] ATPase PPA1 subunit 2 OS=Drosophila melanogaster OX=7227 GN=VhaPPA1-2 PE=3 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0B4J2F0	7.41e-33	108	54	1.000	1.000	PIOS1_HUMAN Protein PIGBOS1 OS=Homo sapiens OX=9606 GN=PIGBOS1 PE=1 SV=1
2	C0HLN0	4.71e-24	86.3	54	0.704	0.704	PIOS1_RAT Protein PIGBOS1 OS=Rattus norvegicus OX=10116 GN=Pigbos1 PE=1 SV=1
3	E7FFT2	0.073	31.6	916	0.259	0.015	TMC2A_DANRE Transmembrane channel-like protein 2-A OS=Danio rerio OX=7955 GN=tmc2a PE=1 SV=2
4	Q39228	2.9	26.9	514	0.278	0.029	STP4_ARATH Sugar transport protein 4 OS=Arabidopsis thaliana OX=3702 GN=STP4 PE=1 SV=1
5	Q8BJG6	3.7	26.6	1214	0.167	0.007	Q8BJG6_MOUSE Pappalysin 2 (Fragment) OS=Mus musculus OX=10090 GN=Pappa2 PE=2 SV=1
6	E9PZ87	3.8	26.6	1789	0.167	0.005	E9PZ87_MOUSE Pappalysin 2 OS=Mus musculus OX=10090 GN=Pappa2 PE=1 SV=1
7	Q9C0X5	4.1	25.8	73	0.278	0.205	YLNA_SCHPO Uncharacterized protein PB8E5.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAPB8E5.10 PE=4 SV=2
8	P17210	9.8	25.4	975	0.204	0.011	KINH_DROME Kinesin heavy chain OS=Drosophila melanogaster OX=7227 GN=Khc PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03929 PepSY_TM	6.9e+02	11.3	PepSY-associated TM region
2	PF03672 UPF0154	48	15.3	Uncharacterised protein family (UPF0154)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000484893

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000164305	0.595	GPI mannosyltransferase 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0080135	0.993	regulation of cellular response to stress
GO:1905897	0.880	regulation of response to endoplasmic reticulum stress
GO:0010646	0.860	regulation of cell communication
GO:0023051	0.858	regulation of signaling
GO:0009966	0.846	regulation of signal transduction
GO:1900101	0.833	regulation of endoplasmic reticulum unfolded protein response
GO:0009987	0.726	cellular process
GO:0008152	0.429	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005741	0.998	mitochondrial outer membrane
GO:0012505	0.511	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]