StarFunc result for job id A0A0G2JNG1

User Input

>input (304 residues)
MSLMVISMACVAFFLLQGAWPHEGFRRKPSLLAHPGPLVKSEETVILQCWSDVMFEHFLL
HREGTFNHTLRLIGEHIDGVSKGNFSIGRMTQDLAGTYRCYGSVTHSPYQLSAPSDPLDI
VITGLYEKPSLSAQPGPTVLAGESVTLFCSSRSSYDMYHLSREGEAHERRLPAGPKVNGT
FQADFPLDPATHGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNSSNSWPSPTEPSSETGN
PRHLHVLIGTSVVKLPFTILLFFLLHRWCSNKKNASVMDQGPAGNRTVNREDSDEQDHQE
VSYA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14952	0.878	0.878	6.951E-52	304	0.941	0.941	Q14952.pdb.gz	KI2S3_HUMAN Killer cell immunoglobulin-like receptor 2DS3 OS=Homo sapiens OX=9606 GN=KIR2DS3 PE=2 SV=1
2	AFDB:P43626	0.730	0.641	4.583E-49	348	0.901	0.787	P43626.pdb.gz	KI2L1_HUMAN Killer cell immunoglobulin-like receptor 2DL1 OS=Homo sapiens OX=9606 GN=KIR2DL1 PE=1 SV=1
3	AFDB:P43632	0.745	0.745	8.978E-48	304	0.875	0.875	P43632.pdb.gz	KI2S4_HUMAN Killer cell immunoglobulin-like receptor 2DS4 OS=Homo sapiens OX=9606 GN=KIR2DS4 PE=1 SV=2
4	AFDB:P43629	0.684	0.478	1.429E-41	444	0.743	0.509	P43629.pdb.gz	KI3L1_HUMAN Killer cell immunoglobulin-like receptor 3DL1 OS=Homo sapiens OX=9606 GN=KIR3DL1 PE=1 SV=1
5	AFDB:P43630	0.636	0.429	2.591E-41	455	0.806	0.538	P43630.pdb.gz	KI3L2_HUMAN Killer cell immunoglobulin-like receptor 3DL2 OS=Homo sapiens OX=9606 GN=KIR3DL2 PE=1 SV=1
6	AFDB:Q8N743	0.638	0.476	1.134E-37	410	0.664	0.493	Q8N743.pdb.gz	KI3L3_HUMAN Killer cell immunoglobulin-like receptor 3DL3 OS=Homo sapiens OX=9606 GN=KIR3DL3 PE=1 SV=2
7	AFDB:Q99706	0.612	0.498	3.052E-34	377	0.612	0.493	Q99706.pdb.gz	KI2L4_HUMAN Killer cell immunoglobulin-like receptor 2DL4 OS=Homo sapiens OX=9606 GN=KIR2DL4 PE=1 SV=3
8	AFDB:Q8N423	0.625	0.328	2.333E-27	598	0.395	0.201	Q8N423.pdb.gz	LIRB2_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 2 OS=Homo sapiens OX=9606 GN=LILRB2 PE=1 SV=5
9	AFDB:O75022	0.616	0.315	3.795E-27	631	0.391	0.189	O75022.pdb.gz	LIRB3_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Homo sapiens OX=9606 GN=LILRB3 PE=1 SV=3
10	AFDB:Q8N149	0.608	0.387	2.521E-26	483	0.316	0.199	Q8N149.pdb.gz	LIRA2_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 2 OS=Homo sapiens OX=9606 GN=LILRA2 PE=1 SV=3
11	PDB:5c6wJ	0.265	0.319	8.030E-8	238	0.099	0.126	5c6wJ.pdb.gz
12	PDB:3bn9F	0.274	0.341	3.946E-6	224	0.095	0.129	3bn9F.pdb.gz
13	PDB:1ngwH	0.264	0.328	9.376E-6	216	0.092	0.130	1ngwH.pdb.gz	Structural evidence for substrate strain in antibody catalysis
14	PDB:7fabH	0.279	0.366	1.103E-5	209	0.099	0.144	7fabH.pdb.gz
15	PDB:6vxkB	0.211	0.117	1.700E-5	747	0.076	0.031	6vxkB.pdb.gz
16	PDB:3c2aL	0.233	0.292	2.228E-5	216	0.089	0.125	3c2aL.pdb.gz	Structure determination of an anti-HIV-1 Fab 447-52D-peptide complex from an epitaxially twinned data set
17	PDB:1a8jL	0.247	0.330	2.482E-5	216	0.079	0.111	1a8jL.pdb.gz	Treatment of osteoarthritis with aspartame.
18	PDB:1ahwA	0.227	0.303	3.253E-5	214	0.102	0.145	1ahwA.pdb.gz
19	PDB:7z0lB	0.223	0.200	3.434E-5	370	0.105	0.086	7z0lB.pdb.gz
20	PDB:6jxrm	0.237	0.280	3.625E-5	248	0.102	0.125	6jxrm.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P43626	0.0	548	348	0.898	0.784	KI2L1_HUMAN Killer cell immunoglobulin-like receptor 2DL1 OS=Homo sapiens OX=9606 GN=KIR2DL1 PE=1 SV=1
2	P43627	0.0	525	348	0.875	0.764	KI2L2_HUMAN Killer cell immunoglobulin-like receptor 2DL2 OS=Homo sapiens OX=9606 GN=KIR2DL2 PE=1 SV=1
3	P43628	0.0	541	341	0.895	0.798	KI2L3_HUMAN Killer cell immunoglobulin-like receptor 2DL3 OS=Homo sapiens OX=9606 GN=KIR2DL3 PE=1 SV=1
4	P43631	0.0	575	304	0.914	0.914	KI2S2_HUMAN Killer cell immunoglobulin-like receptor 2DS2 OS=Homo sapiens OX=9606 GN=KIR2DS2 PE=1 SV=2
5	P43632	0.0	546	304	0.875	0.875	KI2S4_HUMAN Killer cell immunoglobulin-like receptor 2DS4 OS=Homo sapiens OX=9606 GN=KIR2DS4 PE=1 SV=2
6	Q14952	0.0	588	304	0.941	0.941	KI2S3_HUMAN Killer cell immunoglobulin-like receptor 2DS3 OS=Homo sapiens OX=9606 GN=KIR2DS3 PE=2 SV=1
7	Q14953	0.0	623	304	0.990	0.990	KI2S5_HUMAN Killer cell immunoglobulin-like receptor 2DS5 OS=Homo sapiens OX=9606 GN=KIR2DS5 PE=1 SV=2
8	Q14954	0.0	577	304	0.918	0.918	KI2S1_HUMAN Killer cell immunoglobulin-like receptor 2DS1 OS=Homo sapiens OX=9606 GN=KIR2DS1 PE=1 SV=2
9	F2VZG2	7.53e-176	489	293	0.803	0.833	F2VZG2_PANTR KIR2DS4 OS=Pan troglodytes OX=9598 GN=KIR2DS4 PE=1 SV=1
10	P43629	8.30e-155	442	444	0.743	0.509	KI3L1_HUMAN Killer cell immunoglobulin-like receptor 3DL1 OS=Homo sapiens OX=9606 GN=KIR3DL1 PE=1 SV=1
11	P43630	2.83e-151	433	455	0.743	0.497	KI3L2_HUMAN Killer cell immunoglobulin-like receptor 3DL2 OS=Homo sapiens OX=9606 GN=KIR3DL2 PE=1 SV=1
12	Q14943	1.75e-147	421	382	0.691	0.550	KI3S1_HUMAN Killer cell immunoglobulin-like receptor 3DS1 OS=Homo sapiens OX=9606 GN=KIR3DS1 PE=1 SV=2
13	Q8N743	1.39e-137	397	410	0.664	0.493	KI3L3_HUMAN Killer cell immunoglobulin-like receptor 3DL3 OS=Homo sapiens OX=9606 GN=KIR3DL3 PE=1 SV=2
14	Q99706	2.57e-121	354	377	0.612	0.493	KI2L4_HUMAN Killer cell immunoglobulin-like receptor 2DL4 OS=Homo sapiens OX=9606 GN=KIR2DL4 PE=1 SV=3
15	O75022	1.63e-44	162	631	0.332	0.160	LIRB3_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Homo sapiens OX=9606 GN=LILRB3 PE=1 SV=3
16	Q8N423	2.43e-44	161	597	0.336	0.171	LIRB2_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 2 OS=Homo sapiens OX=9606 GN=LILRB2 PE=1 SV=5
17	Q8NHL6	7.48e-43	157	650	0.326	0.152	LIRB1_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 1 OS=Homo sapiens OX=9606 GN=LILRB1 PE=1 SV=1
18	P59901	3.07e-41	151	499	0.299	0.182	LIRA4_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 4 OS=Homo sapiens OX=9606 GN=LILRA4 PE=1 SV=3
19	Q8N6C8	3.81e-41	149	439	0.276	0.191	LIRA3_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 3 OS=Homo sapiens OX=9606 GN=LILRA3 PE=1 SV=3
20	Q8N149	8.41e-41	149	483	0.293	0.184	LIRA2_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 2 OS=Homo sapiens OX=9606 GN=LILRA2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00047 ig	8.9e-18	75.6	Immunoglobulin domain
2	PF13895 Ig_2	0.00025	32.6	Immunoglobulin domain
3	PF13927 Ig_3	0.00012	33.8	Immunoglobulin domain
4	PF16680 Ig_4	1.7e+02	14.2	T-cell surface glycoprotein CD3 delta chain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000342215

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000365402	0.999	HLA class I histocompatibility antigen, Cw-7 alpha chain
2	9606.ENSP00000379873	0.983	HLA class I histocompatibility antigen, A-3 alpha chain
3	9606.ENSP00000371333	0.972	Natural killer cells antigen CD94
4	9606.ENSP00000438038	0.971	NKG2-A/NKG2-B type II integral membrane protein
5	9606.ENSP00000391592	0.962	Tyrosine-protein phosphatase non-receptor type 6
6	9606.ENSP00000371327	0.960	NKG2-C type II integral membrane protein
7	9606.ENSP00000399168	0.957	HLA class I histocompatibility antigen, B-7 alpha chain
8	9606.ENSP00000452780	0.953	Beta-2-microglobulin
9	9606.ENSP00000325525	0.921	Killer cell immunoglobulin-like receptor 3DL2
10	9606.ENSP00000340944	0.914	Tyrosine-protein phosphatase non-receptor type 11
11	9606.ENSP00000336769	0.904	Killer cell immunoglobulin-like receptor 2DL1
12	9606.ENSP00000375608	0.891	Killer cell immunoglobulin-like receptor 3DL1
13	9606.ENSP00000262629	0.885	TYRO protein tyrosine kinase-binding protein
14	9606.ENSP00000365817	0.884	HLA class I histocompatibility antigen, alpha chain E
15	9606.ENSP00000310216	0.870	NKG2-F type II integral membrane protein
16	9606.ENSP00000437563	0.858	Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells
17	9606.ENSP00000412927	0.837	HLA class I histocompatibility antigen, alpha chain G
18	9606.ENSP00000480609	0.825	annotation not available
19	9606.ENSP00000240618	0.822	Killer cell lectin-like receptor subfamily K, member 1
20	9606.ENSP00000291860	0.809	Killer cell immunoglobulin-like receptor 3DL3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0060089	0.395	molecular transducer activity
GO:0038023	0.388	signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.995	response to stimulus
GO:0050794	0.980	regulation of cellular process
GO:0009987	0.979	cellular process
GO:0006952	0.952	defense response
GO:0002376	0.934	immune system process
GO:0007165	0.929	signal transduction
GO:0002682	0.901	regulation of immune system process
GO:0048583	0.896	regulation of response to stimulus
GO:0002764	0.853	immune response-regulating signaling pathway
GO:0048518	0.774	positive regulation of biological process
GO:0007166	0.634	cell surface receptor signaling pathway
GO:0048584	0.501	positive regulation of response to stimulus
GO:0002684	0.489	positive regulation of immune system process
GO:0006955	0.451	immune response
GO:0045088	0.390	regulation of innate immune response
GO:0050778	0.384	positive regulation of immune response
GO:0002768	0.333	immune response-regulating cell surface receptor signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]