StarFunc result for job id A0A0G2JPB7

User Input

>input (455 residues)
MVDFPGYNLSGAVASFLFILLTMKQSEDFRVIGPAHPILAGVGEDALLTCQLLPKRTTMH
VEVRWYRSEPSTPVFVHRDGVEVTEMQMEEYRGWVEWIENGIAKGNVALKIHNIQPSDNG
QYWCHFQDGNYCGETSLLLKVAGLGSAPSIHMEGPGESGVQLVCTARGWFPEPQVYWEDI
RGEKLLAVSEHRIQDKDGLFYAEATLVVRNASAESVSCLVHNPVLTEEKGSVISLPEKLQ
TELASLKVNGPSQPILVRVGEDIQLTCYLSPKANAQSMEVRWDRSHRYPAVHVYMDGDHV
AGEQMAEYRGRTVLVSDAIDEGRLTLQILSARPSDDGQYRCLFEKDDVYQEASLDLKVVG
LGSSPLITVEGQEDGEMQLICSSDGWFPQPHVQWRDMEGKTIPSSSQALTQGSHGLFHVQ
TLLRVTNISAVDVTCSISIPFLGEEKIATFSLSGW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UIR0	0.982	0.982	1.165E-87	455	0.991	0.991	Q9UIR0.pdb.gz	BTNL2_HUMAN Butyrophilin-like protein 2 OS=Homo sapiens OX=9606 GN=BTNL2 PE=1 SV=1
2	AFDB:O70355	0.941	0.943	9.622E-67	454	0.644	0.645	O70355.pdb.gz	BTNL2_MOUSE Butyrophilin-like protein 2 OS=Mus musculus OX=10090 GN=Btnl2 PE=1 SV=2
3	AFDB:Q5ZPR3	0.431	0.375	1.371E-35	534	0.251	0.213	Q5ZPR3.pdb.gz	CD276_HUMAN CD276 antigen OS=Homo sapiens OX=9606 GN=CD276 PE=1 SV=1
4	AFDB:Q13410	0.479	0.417	4.654E-27	526	0.275	0.238	Q13410.pdb.gz	BT1A1_HUMAN Butyrophilin subfamily 1 member A1 OS=Homo sapiens OX=9606 GN=BTN1A1 PE=1 SV=3
5	AFDB:Q7TST0	0.452	0.405	3.074E-26	509	0.202	0.181	Q7TST0.pdb.gz	BTNL1_MOUSE Butyrophilin-like protein 1 OS=Mus musculus OX=10090 GN=Btnl1 PE=2 SV=3
6	AFDB:Q8WVV5	0.447	0.389	3.235E-26	523	0.196	0.170	Q8WVV5.pdb.gz	BT2A2_HUMAN Butyrophilin subfamily 2 member A2 OS=Homo sapiens OX=9606 GN=BTN2A2 PE=1 SV=2
7	AFDB:A4QPC6	0.452	0.401	4.393E-26	514	0.255	0.226	A4QPC6.pdb.gz	BT2A2_MOUSE Butyrophilin subfamily 2 member A2 OS=Mus musculus OX=10090 GN=Btn2a2 PE=1 SV=1
8	AFDB:Q6MG92	0.398	0.319	1.101E-25	588	0.237	0.184	Q6MG92.pdb.gz	Q6MG92_RAT Butyrophilin-like 8 OS=Rattus norvegicus OX=10116 GN=Btnl8 PE=3 SV=1
9	AFDB:A0A0G2K9U4	0.413	0.588	1.158E-25	303	0.204	0.307	A0A0G2K9U4.pdb.gz	A0A0G2K9U4_RAT Butyrophilin-like 8 OS=Rattus norvegicus OX=10116 GN=Btnl8 PE=4 SV=2
10	AFDB:Q7KYR7	0.444	0.384	1.158E-25	527	0.198	0.171	Q7KYR7.pdb.gz	BT2A1_HUMAN Butyrophilin subfamily 2 member A1 OS=Homo sapiens OX=9606 GN=BTN2A1 PE=1 SV=3
11	PDB:1igtB	0.213	0.217	1.801E-16	444	0.182	0.187	1igtB.pdb.gz	Refined structure of an intact IgG2a monoclonal antibody.
12	PDB:1hzhH	0.226	0.225	2.324E-16	457	0.158	0.158	1hzhH.pdb.gz	Crystal structure of a neutralizing human IGG against HIV-1: a template for vaccine design.
13	PDB:5oj2B	0.402	0.295	2.324E-16	692	0.149	0.098	5oj2B.pdb.gz
14	PDB:1e07A	0.273	0.203	3.496E-16	642	0.156	0.111	1e07A.pdb.gz
15	PDB:1igaA	0.211	0.204	1.981E-15	475	0.180	0.173	1igaA.pdb.gz
16	PDB:2rcjC	0.222	0.203	3.278E-14	523	0.169	0.147	2rcjC.pdb.gz
17	PDB:1zvoC	0.208	0.187	8.642E-14	512	0.152	0.135	1zvoC.pdb.gz
18	PDB:6dldD	0.192	0.292	2.151E-12	269	0.130	0.219	6dldD.pdb.gz
19	PDB:1jnhA	0.214	0.404	5.352E-11	208	0.081	0.178	1jnhA.pdb.gz	Highly specific anti-estradiol antibodies: structural characterisation and binding diversity.
20	PDB:1q0xL	0.233	0.416	1.341E-10	212	0.088	0.189	1q0xL.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O70355	0.0	605	454	0.644	0.645	BTNL2_MOUSE Butyrophilin-like protein 2 OS=Mus musculus OX=10090 GN=Btnl2 PE=1 SV=2
2	Q9UIR0	0.0	933	455	0.991	0.991	BTNL2_HUMAN Butyrophilin-like protein 2 OS=Homo sapiens OX=9606 GN=BTNL2 PE=1 SV=1
3	Q7TST0	2.17e-57	199	509	0.207	0.185	BTNL1_MOUSE Butyrophilin-like protein 1 OS=Mus musculus OX=10090 GN=Btnl1 PE=2 SV=3
4	A0A0G2K9U4	1.79e-56	192	346	0.209	0.275	A0A0G2K9U4_RAT Butyrophilin-like 8 OS=Rattus norvegicus OX=10116 GN=Btnl8 PE=4 SV=2
5	Q7KYR7	3.53e-56	196	527	0.215	0.186	BT2A1_HUMAN Butyrophilin subfamily 2 member A1 OS=Homo sapiens OX=9606 GN=BTN2A1 PE=1 SV=3
6	Q13410	3.72e-56	196	526	0.235	0.203	BT1A1_HUMAN Butyrophilin subfamily 1 member A1 OS=Homo sapiens OX=9606 GN=BTN1A1 PE=1 SV=3
7	M0RD77	2.29e-55	188	313	0.207	0.300	M0RD77_RAT Butyrophilin-like 8 OS=Rattus norvegicus OX=10116 GN=Btnl8 PE=4 SV=1
8	Q8WVV5	4.41e-55	193	523	0.211	0.184	BT2A2_HUMAN Butyrophilin subfamily 2 member A2 OS=Homo sapiens OX=9606 GN=BTN2A2 PE=1 SV=2
9	A2CG22	6.64e-53	187	539	0.204	0.173	A2CG22_MOUSE Butyrophilin-like 6 OS=Mus musculus OX=10090 GN=Btnl6 PE=1 SV=1
10	Q6MG92	1.36e-52	188	588	0.207	0.160	Q6MG92_RAT Butyrophilin-like 8 OS=Rattus norvegicus OX=10116 GN=Btnl8 PE=3 SV=1
11	P78410	1.05e-51	179	334	0.193	0.263	BT3A2_HUMAN Butyrophilin subfamily 3 member A2 OS=Homo sapiens OX=9606 GN=BTN3A2 PE=1 SV=2
12	Q62556	2.56e-50	180	524	0.193	0.168	BT1A1_MOUSE Butyrophilin subfamily 1 member A1 OS=Mus musculus OX=10090 GN=Btn1a1 PE=1 SV=2
13	A4QPC6	3.13e-49	177	514	0.198	0.175	BT2A2_MOUSE Butyrophilin subfamily 2 member A2 OS=Mus musculus OX=10090 GN=Btn2a2 PE=1 SV=1
14	O00478	6.23e-49	178	584	0.207	0.161	BT3A3_HUMAN Butyrophilin subfamily 3 member A3 OS=Homo sapiens OX=9606 GN=BTN3A3 PE=1 SV=1
15	O00481	5.60e-47	171	513	0.200	0.177	BT3A1_HUMAN Butyrophilin subfamily 3 member A1 OS=Homo sapiens OX=9606 GN=BTN3A1 PE=1 SV=3
16	Q6UXG8	2.08e-44	164	535	0.180	0.153	BTNL9_HUMAN Butyrophilin-like protein 9 OS=Homo sapiens OX=9606 GN=BTNL9 PE=1 SV=1
17	A7TZE6	6.46e-41	151	364	0.165	0.206	SKIT1_MOUSE Selection and upkeep of intraepithelial T-cells protein 1 OS=Mus musculus OX=10090 GN=Skint1 PE=1 SV=1
18	Q6UX41	6.96e-41	154	500	0.176	0.160	BTNL8_HUMAN Butyrophilin-like protein 8 OS=Homo sapiens OX=9606 GN=BTNL8 PE=1 SV=1
19	Q5ZPR3	7.52e-41	155	534	0.262	0.223	CD276_HUMAN CD276 antigen OS=Homo sapiens OX=9606 GN=CD276 PE=1 SV=1
20	Q6UXE8	3.03e-39	149	466	0.169	0.165	BTNL3_HUMAN Butyrophilin-like protein 3 OS=Homo sapiens OX=9606 GN=BTNL3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07654 C1-set	0.0013	30.4	Immunoglobulin C1-set domain
2	PF08205 C2-set_2	3.5e-08	44.7	CD80-like C2-set immunoglobulin domain
3	PF07679 I-set	2.1e-15	67.9	Immunoglobulin I-set domain
4	PF00047 ig	1.1e-05	36.9	Immunoglobulin domain
5	PF13895 Ig_2	5.7e-08	44.3	Immunoglobulin domain
6	PF13927 Ig_3	2e-20	84.4	Immunoglobulin domain
7	PF16706 Izumo-Ig	7.9	17.8	Izumo-like Immunoglobulin domain
8	PF07686 V-set	1.7e-24	97.5	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000390613

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000353099	0.967	HLA class II histocompatibility antigen, DRB1-15 beta chain
2	9606.ENSP00000415517	0.779	Uncharacterized protein C6orf10
3	9606.ENSP00000398610	0.704	Annexin A11
4	9606.ENSP00000378786	0.674	HLA class II histocompatibility antigen, DR alpha chain
5	9606.ENSP00000364080	0.647	HLA class II histocompatibility antigen, DQ beta 1 chain
6	9606.ENSP00000369566	0.641	Interferon alpha-10
7	9606.ENSP00000363794	0.623	Estradiol 17-beta-dehydrogenase 8
8	9606.ENSP00000378704	0.599	Bromodomain-containing protein 2
9	9606.ENSP00000364805	0.575	Heat shock 70 kDa protein 1-like
10	9606.ENSP00000441405	0.542	Zinc finger protein 664
11	9606.ENSP00000364114	0.538	HLA class II histocompatibility antigen, DR beta 5 chain
12	9606.ENSP00000364076	0.526	HLA class II histocompatibility antigen, DQ alpha 2 chain
13	9606.ENSP00000363840	0.514	Collagen alpha-2(XI) chain
14	9606.ENSP00000418259	0.512	ZFP57 zinc finger protein
15	9606.ENSP00000364163	0.502	Neurogenic locus notch homolog protein 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.986	regulation of biological process
GO:0050794	0.975	regulation of cellular process
GO:0001817	0.868	regulation of cytokine production
GO:0051249	0.862	regulation of lymphocyte activation
GO:0002684	0.858	positive regulation of immune system process
GO:0009987	0.856	cellular process
GO:0050863	0.846	regulation of T cell activation
GO:0022407	0.837	regulation of cell-cell adhesion
GO:0051251	0.833	positive regulation of lymphocyte activation
GO:1903037	0.821	regulation of leukocyte cell-cell adhesion
GO:0070663	0.798	regulation of leukocyte proliferation
GO:0048583	0.759	regulation of response to stimulus
GO:0032944	0.728	regulation of mononuclear cell proliferation
GO:0050670	0.695	regulation of lymphocyte proliferation
GO:0042129	0.657	regulation of T cell proliferation
GO:0048519	0.606	negative regulation of biological process
GO:0010604	0.481	positive regulation of macromolecule metabolic process
GO:0050896	0.397	response to stimulus
GO:0050776	0.357	regulation of immune response
GO:0048523	0.317	negative regulation of cellular process
GO:0022409	0.315	positive regulation of cell-cell adhesion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.996	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]