StarFunc result for job id A0A0G2JQ47

User Input

>input (297 residues)
MACVGFFLLQGAWPHEGVHRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGMFN
DTLRLIGEHHDGVSKANFSISRMKQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVIIGLYE
KPSLSAQPGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGTKVNGTFQANFPL
GPATHGGTYRCFGSFRDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLHVL
IGTSVVKIPFTILLFFLLHRWCSDKKNAAVMDQEPAGNRTVNSEDSDEQDHQEVSYA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P43626	0.754	0.653	1.263E-50	348	0.936	0.799	P43626.pdb.gz	KI2L1_HUMAN Killer cell immunoglobulin-like receptor 2DL1 OS=Homo sapiens OX=9606 GN=KIR2DL1 PE=1 SV=1
2	AFDB:P43632	0.751	0.735	3.158E-50	304	0.916	0.895	P43632.pdb.gz	KI2S4_HUMAN Killer cell immunoglobulin-like receptor 2DS4 OS=Homo sapiens OX=9606 GN=KIR2DS4 PE=1 SV=2
3	AFDB:Q14952	0.767	0.750	7.481E-50	304	0.912	0.891	Q14952.pdb.gz	KI2S3_HUMAN Killer cell immunoglobulin-like receptor 2DS3 OS=Homo sapiens OX=9606 GN=KIR2DS3 PE=2 SV=1
4	AFDB:P43630	0.670	0.440	2.546E-43	455	0.774	0.505	P43630.pdb.gz	KI3L2_HUMAN Killer cell immunoglobulin-like receptor 3DL2 OS=Homo sapiens OX=9606 GN=KIR3DL2 PE=1 SV=1
5	AFDB:P43629	0.701	0.481	2.836E-43	444	0.781	0.523	P43629.pdb.gz	KI3L1_HUMAN Killer cell immunoglobulin-like receptor 3DL1 OS=Homo sapiens OX=9606 GN=KIR3DL1 PE=1 SV=1
6	AFDB:Q8N743	0.661	0.481	7.545E-39	410	0.694	0.502	Q8N743.pdb.gz	KI3L3_HUMAN Killer cell immunoglobulin-like receptor 3DL3 OS=Homo sapiens OX=9606 GN=KIR3DL3 PE=1 SV=2
7	AFDB:Q99706	0.618	0.491	1.127E-33	377	0.620	0.488	Q99706.pdb.gz	KI2L4_HUMAN Killer cell immunoglobulin-like receptor 2DL4 OS=Homo sapiens OX=9606 GN=KIR2DL4 PE=1 SV=3
8	AFDB:P59901	0.635	0.388	2.039E-26	499	0.337	0.200	P59901.pdb.gz	LIRA4_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 4 OS=Homo sapiens OX=9606 GN=LILRA4 PE=1 SV=3
9	AFDB:O75022	0.616	0.308	2.152E-26	631	0.380	0.179	O75022.pdb.gz	LIRB3_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Homo sapiens OX=9606 GN=LILRB3 PE=1 SV=3
10	AFDB:Q8N423	0.626	0.325	2.974E-26	598	0.397	0.197	Q8N423.pdb.gz	LIRB2_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 2 OS=Homo sapiens OX=9606 GN=LILRB2 PE=1 SV=5
11	PDB:5c6wJ	0.267	0.313	1.457E-8	238	0.098	0.122	5c6wJ.pdb.gz
12	PDB:1cf8L	0.287	0.373	5.479E-6	215	0.084	0.116	1cf8L.pdb.gz	Convergence of Catalytic Antibody and Terpene Cyclase Mechanisms: Polyene Cyclization Directed by Carbocation-pi Interactions
13	PDB:1ngwH	0.281	0.347	6.103E-6	216	0.104	0.144	1ngwH.pdb.gz	Structural evidence for substrate strain in antibody catalysis
14	PDB:1ahwA	0.236	0.303	7.174E-6	214	0.098	0.136	1ahwA.pdb.gz
15	PDB:7fabH	0.303	0.378	7.990E-6	209	0.101	0.144	7fabH.pdb.gz
16	PDB:3bn9F	0.302	0.363	8.433E-6	224	0.104	0.138	3bn9F.pdb.gz
17	PDB:6vpyL	0.287	0.360	9.393E-6	209	0.081	0.115	6vpyL.pdb.gz
18	PDB:1aifA	0.273	0.358	9.913E-6	215	0.104	0.144	1aifA.pdb.gz
19	PDB:6vxkB	0.213	0.115	9.913E-6	747	0.084	0.033	6vxkB.pdb.gz
20	PDB:7cztH	0.293	0.374	9.913E-6	221	0.101	0.136	7cztH.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P43626	0.0	560	348	0.939	0.802	KI2L1_HUMAN Killer cell immunoglobulin-like receptor 2DL1 OS=Homo sapiens OX=9606 GN=KIR2DL1 PE=1 SV=1
2	P43627	0.0	535	348	0.906	0.773	KI2L2_HUMAN Killer cell immunoglobulin-like receptor 2DL2 OS=Homo sapiens OX=9606 GN=KIR2DL2 PE=1 SV=1
3	P43628	0.0	540	341	0.909	0.792	KI2L3_HUMAN Killer cell immunoglobulin-like receptor 2DL3 OS=Homo sapiens OX=9606 GN=KIR2DL3 PE=1 SV=1
4	P43631	0.0	579	304	0.939	0.918	KI2S2_HUMAN Killer cell immunoglobulin-like receptor 2DS2 OS=Homo sapiens OX=9606 GN=KIR2DS2 PE=1 SV=2
5	P43632	0.0	569	304	0.923	0.901	KI2S4_HUMAN Killer cell immunoglobulin-like receptor 2DS4 OS=Homo sapiens OX=9606 GN=KIR2DS4 PE=1 SV=2
6	Q14952	0.0	567	304	0.919	0.898	KI2S3_HUMAN Killer cell immunoglobulin-like receptor 2DS3 OS=Homo sapiens OX=9606 GN=KIR2DS3 PE=2 SV=1
7	Q14953	0.0	569	304	0.926	0.905	KI2S5_HUMAN Killer cell immunoglobulin-like receptor 2DS5 OS=Homo sapiens OX=9606 GN=KIR2DS5 PE=1 SV=2
8	Q14954	0.0	621	304	1.000	0.977	KI2S1_HUMAN Killer cell immunoglobulin-like receptor 2DS1 OS=Homo sapiens OX=9606 GN=KIR2DS1 PE=1 SV=2
9	F2VZG2	1.32e-178	496	293	0.825	0.836	F2VZG2_PANTR KIR2DS4 OS=Pan troglodytes OX=9598 GN=KIR2DS4 PE=1 SV=1
10	P43629	3.12e-161	457	444	0.781	0.523	KI3L1_HUMAN Killer cell immunoglobulin-like receptor 3DL1 OS=Homo sapiens OX=9606 GN=KIR3DL1 PE=1 SV=1
11	P43630	9.14e-156	444	455	0.774	0.505	KI3L2_HUMAN Killer cell immunoglobulin-like receptor 3DL2 OS=Homo sapiens OX=9606 GN=KIR3DL2 PE=1 SV=1
12	Q14943	6.51e-152	432	382	0.707	0.550	KI3S1_HUMAN Killer cell immunoglobulin-like receptor 3DS1 OS=Homo sapiens OX=9606 GN=KIR3DS1 PE=1 SV=2
13	Q8N743	1.04e-144	414	410	0.697	0.505	KI3L3_HUMAN Killer cell immunoglobulin-like receptor 3DL3 OS=Homo sapiens OX=9606 GN=KIR3DL3 PE=1 SV=2
14	Q99706	1.53e-121	354	377	0.623	0.491	KI2L4_HUMAN Killer cell immunoglobulin-like receptor 2DL4 OS=Homo sapiens OX=9606 GN=KIR2DL4 PE=1 SV=3
15	Q8NHL6	1.33e-44	162	650	0.343	0.157	LIRB1_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 1 OS=Homo sapiens OX=9606 GN=LILRB1 PE=1 SV=1
16	O75022	3.40e-43	158	631	0.340	0.160	LIRB3_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Homo sapiens OX=9606 GN=LILRB3 PE=1 SV=3
17	Q8N423	1.29e-42	156	597	0.333	0.166	LIRB2_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 2 OS=Homo sapiens OX=9606 GN=LILRB2 PE=1 SV=5
18	O75023	3.29e-41	152	590	0.347	0.175	LIRB5_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 5 OS=Homo sapiens OX=9606 GN=LILRB5 PE=1 SV=2
19	P59901	6.63e-41	150	499	0.310	0.184	LIRA4_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 4 OS=Homo sapiens OX=9606 GN=LILRA4 PE=1 SV=3
20	Q8N149	6.14e-40	147	483	0.303	0.186	LIRA2_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 2 OS=Homo sapiens OX=9606 GN=LILRA2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00047 ig	3.9e-18	76.7	Immunoglobulin domain
2	PF13895 Ig_2	6.7e-05	34.4	Immunoglobulin domain
3	PF13927 Ig_3	2.1e-05	36.3	Immunoglobulin domain
4	PF16680 Ig_4	9.7e+02	11.8	T-cell surface glycoprotein CD3 delta chain
5	PF07686 V-set	58	15.3	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000336769

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000365402	0.999	HLA class I histocompatibility antigen, Cw-7 alpha chain
2	9606.ENSP00000371333	0.972	Natural killer cells antigen CD94
3	9606.ENSP00000438038	0.972	NKG2-A/NKG2-B type II integral membrane protein
4	9606.ENSP00000452780	0.971	Beta-2-microglobulin
5	9606.ENSP00000371327	0.960	NKG2-C type II integral membrane protein
6	9606.ENSP00000340944	0.943	Tyrosine-protein phosphatase non-receptor type 11
7	9606.ENSP00000379873	0.940	HLA class I histocompatibility antigen, A-3 alpha chain
8	9606.ENSP00000399168	0.918	HLA class I histocompatibility antigen, B-7 alpha chain
9	9606.ENSP00000365817	0.916	HLA class I histocompatibility antigen, alpha chain E
10	9606.ENSP00000342215	0.904	Killer cell immunoglobulin-like receptor 2DL3
11	9606.ENSP00000375608	0.864	Killer cell immunoglobulin-like receptor 3DL1
12	9606.ENSP00000391592	0.862	Tyrosine-protein phosphatase non-receptor type 6
13	9606.ENSP00000325525	0.861	Killer cell immunoglobulin-like receptor 3DL2
14	9606.ENSP00000240618	0.860	Killer cell lectin-like receptor subfamily K, member 1
15	9606.ENSP00000310216	0.859	NKG2-F type II integral membrane protein
16	9606.ENSP00000437563	0.858	Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells
17	9606.ENSP00000412927	0.839	HLA class I histocompatibility antigen, alpha chain G
18	9606.ENSP00000480609	0.829	annotation not available
19	9606.ENSP00000342156	0.814	Natural cytotoxicity triggering receptor 3
20	9606.ENSP00000291860	0.810	Killer cell immunoglobulin-like receptor 3DL3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0038023	0.522	signaling receptor activity
GO:0004888	0.464	transmembrane signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.995	response to stimulus
GO:0009987	0.981	cellular process
GO:0050794	0.981	regulation of cellular process
GO:0006952	0.973	defense response
GO:0002376	0.945	immune system process
GO:0007165	0.926	signal transduction
GO:0002682	0.900	regulation of immune system process
GO:0048583	0.893	regulation of response to stimulus
GO:0002764	0.841	immune response-regulating signaling pathway
GO:0007166	0.836	cell surface receptor signaling pathway
GO:0048518	0.612	positive regulation of biological process
GO:0048584	0.518	positive regulation of response to stimulus
GO:0002684	0.454	positive regulation of immune system process
GO:0006955	0.447	immune response
GO:0002831	0.367	regulation of response to biotic stimulus
GO:0031347	0.349	regulation of defense response
GO:0050778	0.334	positive regulation of immune response
GO:0032101	0.327	regulation of response to external stimulus
GO:0045088	0.314	regulation of innate immune response

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]