StarFunc result for job id A0A0J9YWL9

User Input

>input (993 residues)
MAMNFGDHASGFRHDDVIRFINNEVLRNGGSPAFYTAFRSRPWNEVEDRLRAIVADPRVP
RAIKRACTWSALALSVQVAARQQEELLYQVWWLQGHVEECQATSWALTSQLQQLRLEHEE
VATQLHLTQAALQQVLNERDGLCGRLLEVERSMQVYPMPQDFVPGPEAGQYGPVAGTLNA
EQSEAVATEAQGMPHSEAQVAAPTAVYYMPEPQSGRVQGMQPLLLMQAPHPVPFHMPSPM
GLPYSTPLPPPVVMESAAAIAPQMPPAGIYPPGLWATVGSQEETAPPWDQKCHGQDGYPE
NFQGVYHPGDNRSCNQKEGSECPQGMTSQGDSSSHSLKKDPVMQEGTAPPEFSRSHSLEK
KPVMPKEMVPLGDSNSHSLKKDPVVPKEIVPIGDSNSHSLTKNPVVHKEMVSLGDSNSHS
MKKDPVMPQKMVPLGDSNSHSLKKDPMMCQEMVPLGDSNSHSLKKDPVVAQGTAPLMYSR
RHSQKKVPMMPKEMVPLGESHSHSLKKDLVVPKELVPLGDSKSHRMKKDPVMPQKMVPLG
DSRSHSLKKDPVMPQNMIPLEDSNSHSLKKDPVMPQNMIPLEDSNSHSLKKDPMMHQEMV
PLGDSNSHSLKKDPVVPQDTAPLMFSRRHSLKKVPVMPKEMVPLGDSHSLKKDPVMPQNM
VPLEDSNSHSLKKDPVVPQGTAPLMFSRRHSLKKVPVMPKEMVPLGDSNSHSLKKDPVVP
QGTAPLMFSRRHSLKKVPVMPKEMVPLGDSHSLKKDPVMPQNMVPLEDSNSHSLKKDPVV
PQGTAPLTFSRRHSLKKVPVVPQGTASLGFSRIHSLKKELVMPEEMVPLGDSNSHSMKKD
LVMPKEMVPLGDSNSHSLKKDPVVHQEVVSLGDSNSHSLKKHPVIPQGTASLRFSKSHSQ
KEDQERPQVTPLEDSKSHGVKNSPWKHQPQGQKVKEQKRKKASESQQQKPASCSSPVNWA
CPWCNAMNFPRNKVCSKCKRVRMPVENGSVDPA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BXU2	0.142	0.409	3.292E-8	312	0.093	0.295	Q9BXU2.pdb.gz	TX13B_HUMAN Testis-expressed protein 13B OS=Homo sapiens OX=9606 GN=TEX13B PE=1 SV=1
2	AFDB:Q9BXU3	0.141	0.313	7.132E-8	409	0.094	0.227	Q9BXU3.pdb.gz	TX13A_HUMAN Testis-expressed protein 13A OS=Homo sapiens OX=9606 GN=TEX13A PE=1 SV=1
3	AFDB:Q9HDY9	0.048	0.046	5.316E-1	1082	0.068	0.063	Q9HDY9.pdb.gz	MAM3_SCHPO M cell-type agglutination protein mam3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mam3 PE=3 SV=2
4	AFDB:Q8T9B8	0.050	0.055	6.376E-1	874	0.101	0.114	Q8T9B8.pdb.gz	Q8T9B8_DROME SD08060p OS=Drosophila melanogaster OX=7227 GN=Brd8 PE=2 SV=1
5	PDB:7aqqx	0.052	0.096	7.342E-1	214	0.019	0.089	7aqqx.pdb.gz	A ferredoxin bridge connects the two arms of plant mitochondrial complex I.
6	PDB:1thjA	0.052	0.110	9.216E-1	213	0.030	0.141	1thjA.pdb.gz	A left-hand beta-helix revealed by the crystal structure of a carbonic anhydrase from the archaeon Methanosarcina thermophila.
7	AFDB:P49750	0.045	0.024	9.600E-1	2146	0.152	0.070	P49750.pdb.gz	YLPM1_HUMAN YLP motif-containing protein 1 OS=Homo sapiens OX=9606 GN=YLPM1 PE=1 SV=4
8	AFDB:Q12124	0.088	0.178	1.005	431	0.046	0.107	Q12124.pdb.gz	MED2_YEAST Mediator of RNA polymerase II transcription subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MED2 PE=1 SV=1
9	AFDB:Q2M3C6	0.082	0.146	1.151	531	0.050	0.094	Q2M3C6.pdb.gz	TM266_HUMAN Transmembrane protein 266 OS=Homo sapiens OX=9606 GN=TMEM266 PE=1 SV=2
10	AFDB:Q8BVF5	0.081	0.176	1.261	381	0.054	0.142	Q8BVF5.pdb.gz	Q8BVF5_MOUSE Kinetochore protein Cenp-F/LEK1 Rb protein-binding domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Cenpf PE=2 SV=1
11	PDB:3tv0A	0.035	0.097	1.326	143	0.014	0.098	3tv0A.pdb.gz
12	AFDB:F5H2X7	0.061	0.063	1.381	954	0.118	0.123	F5H2X7.pdb.gz	F5H2X7_HUMAN CDKN1A interacting zinc finger protein 1 OS=Homo sapiens OX=9606 GN=CIZ1 PE=1 SV=2
13	AFDB:H7C179	0.051	0.057	1.513	861	0.103	0.118	H7C179.pdb.gz	H7C179_HUMAN Bromodomain containing 8 (Fragment) OS=Homo sapiens OX=9606 GN=BRD8 PE=1 SV=1
14	PDB:2jf2A	0.060	0.123	3.146	264	0.017	0.064	2jf2A.pdb.gz
15	PDB:7r7jB	0.028	0.048	3.949	574	0.009	0.016	7r7jB.pdb.gz	X-ray crystal structure of the Escherichia coli RadD DNA repair protein bound to ADP reveals a novel zinc ribbon domain.
16	PDB:6jlzI	0.046	0.075	4.133	430	0.005	0.012	6jlzI.pdb.gz	Structural basis for eIF2B inhibition in integrated stress response.
17	PDB:7n6g3I	0.066	0.151	4.325	401	0.026	0.065	7n6g3I.pdb.gz	Cryo-EM structure of an active central apparatus.
18	PDB:6lthN	0.091	0.262	4.526	261	0.020	0.077	6lthN.pdb.gz	Structure of nucleosome-bound human BAF complex.
19	PDB:3d8vA	0.068	0.102	4.957	478	0.011	0.023	3d8vA.pdb.gz	Structure and function of GlmU from Mycobacterium tuberculosis.
20	PDB:7ojpZ	0.057	0.105	4.957	261	0.024	0.092	7ojpZ.pdb.gz	Discovery of Novel UDP- N -Acetylglucosamine Acyltransferase (LpxA) Inhibitors with Activity against Pseudomonas aeruginosa .

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BXU2	5.19e-25	108	312	0.063	0.202	TX13B_HUMAN Testis-expressed protein 13B OS=Homo sapiens OX=9606 GN=TEX13B PE=1 SV=1
2	Q9BXU3	8.79e-25	110	409	0.060	0.147	TX13A_HUMAN Testis-expressed protein 13A OS=Homo sapiens OX=9606 GN=TEX13A PE=1 SV=1
3	Q586F2	5.46e-06	53.1	1242	0.125	0.100	Q586F2_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=1F7.300 PE=4 SV=1
4	Q9LP67	0.036	40.0	455	0.015	0.033	Q9LP67_ARATH T1N15.19 OS=Arabidopsis thaliana OX=3702 GN=At1g48570 PE=1 SV=1
5	F4I6V3	0.50	36.6	466	0.014	0.030	F4I6V3_ARATH Ran BP2/NZF zinc finger-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At1g70650 PE=1 SV=1
6	Q9C7M2	0.63	36.6	849	0.011	0.013	Q9C7M2_ARATH Uncharacterized protein F14C21.55 OS=Arabidopsis thaliana OX=3702 GN=SED1 PE=1 SV=1
7	F4JCU0	0.78	36.2	1007	0.014	0.014	SUA_ARATH SUPPRESSOR OF ABI3-5 OS=Arabidopsis thaliana OX=3702 GN=SUA PE=1 SV=2
8	Q04118	0.91	35.4	309	0.040	0.129	PRB3_HUMAN Basic salivary proline-rich protein 3 OS=Homo sapiens OX=9606 GN=PRB3 PE=1 SV=2
9	Q8S9K3	1.4	35.4	758	0.011	0.015	VAR3_ARATH Zinc finger protein VAR3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=VAR3 PE=1 SV=2
10	Q09363	2.5	34.3	356	0.018	0.051	SQV8_CAEEL Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase sqv-8 OS=Caenorhabditis elegans OX=6239 GN=sqv-8 PE=1 SV=1
11	O81635	5.8	33.5	987	0.026	0.026	KN14G_ARATH Kinesin-like protein KIN-14G OS=Arabidopsis thaliana OX=3702 GN=KIN14G PE=1 SV=2
12	Q4TZQ4	8.0	32.7	831	0.010	0.012	Q4TZQ4_DROME TAK1-binding protein OS=Drosophila melanogaster OX=7227 GN=Tab2 PE=2 SV=1
13	Q6NQZ7	8.3	32.7	831	0.010	0.012	Q6NQZ7_DROME LD40663p OS=Drosophila melanogaster OX=7227 GN=Tab2 PE=2 SV=1
14	Q9NFL3	8.3	32.7	831	0.010	0.012	Q9NFL3_DROME Transcription factor OS=Drosophila melanogaster OX=7227 GN=Tab2 PE=2 SV=1
15	A0A0B4KG87	8.6	32.7	820	0.010	0.012	A0A0B4KG87_DROME TAK1-associated binding protein 2, isoform C OS=Drosophila melanogaster OX=7227 GN=Tab2 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01212 Beta_elim_lyase	0.00076	30.4	Beta-eliminating lyase
2	PF10078 DUF2316	29	16.3	Uncharacterized protein conserved in bacteria (DUF2316)
3	PF15101 TERB2	9.1e+02	11.2	Telomere-associated protein TERB2
4	PF15186 TEX13	2.4e-56	201.0	Testis-expressed sequence 13 protein family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9668.ENSMPUP00000001330

Rank	PPI partner	STRING score	Description
1	9668.ENSMPUP00000004073	0.840	Glutamate-rich WD repeat containing 1
2	9668.ENSMPUP00000009568	0.840	DNA-directed RNA polymerase subunit beta
3	9668.ENSMPUP00000005089	0.838	Pumilio RNA binding family member 3
4	9668.ENSMPUP00000014800	0.838	pre-rRNA processing protein FTSJ3
5	9668.ENSMPUP00000009861	0.837	PWP2 periodic tryptophan protein homolog (yeast)
6	9668.ENSMPUP00000007144	0.836	UTP4, small subunit processome component
7	9668.ENSMPUP00000011544	0.836	RNA cytidine acetyltransferase
8	9668.ENSMPUP00000012136	0.836	PWP1 homolog, endonuclein
9	9668.ENSMPUP00000017167	0.836	BMS1 ribosome biogenesis factor
10	9668.ENSMPUP00000014946	0.835	Apoptosis antagonizing transcription factor
11	9668.ENSMPUP00000016117	0.835	Nucleolar GTP-binding protein 1
12	9668.ENSMPUP00000017874	0.835	WD repeat domain 43
13	9668.ENSMPUP00000000377	0.834	Ribosome biogenesis protein WDR12
14	9668.ENSMPUP00000003084	0.834	Digestive organ expansion factor homolog (zebrafish)
15	9668.ENSMPUP00000006456	0.834	RNA binding motif protein 28
16	9668.ENSMPUP00000010812	0.834	NOP14 nucleolar protein
17	9668.ENSMPUP00000012901	0.834	TSR1, ribosome maturation factor
18	9668.ENSMPUP00000013727	0.834	NOC2 like nucleolar associated transcriptional repressor
19	9668.ENSMPUP00000014600	0.834	Nucleolar GTP-binding protein 2
20	9668.ENSMPUP00000000882	0.833	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.440	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0043226	0.989	organelle
GO:0043227	0.984	membrane-bounded organelle
GO:0005622	0.965	intracellular anatomical structure
GO:0005737	0.722	cytoplasm
GO:0043229	0.647	intracellular organelle
GO:0016020	0.420	membrane
GO:0031974	0.343	membrane-enclosed lumen
GO:0043231	0.336	intracellular membrane-bounded organelle
GO:0070013	0.312	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]