StarFunc result for job id A0A0U1RQE8

User Input

>input (302 residues)
MILLNNSERLLALFKSLARSIPESLKVYGSLFHINHGNPFNMEVLVDSWPEYQMVIIRPQ
KQEMTDDMDSYTNVYRVFSKDPQKSQEVLKNSEIINWKQKLQIQGFQESLGEGIRAAAFS
NSVKVEHSRALLFVTEDILKLYATNKSKLGSWAETGHPDDELESETPNFKYAQLNVSYSG
LVNDNWKLGMNKRSLRYIKRCLGALPAACMLGPEGVPVSWVTMDPSCEIGMGYSVEKYRR
RGNGTRLIMRCMKYLCQKNIPFYGSVLEENQGVIRKTSALGFLEASCQWHQWNCYPQNLV
PL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q969I3	0.976	0.976	8.707E-53	302	0.825	0.825	Q969I3.pdb.gz	GLYL1_HUMAN Glycine N-acyltransferase-like protein 1 OS=Homo sapiens OX=9606 GN=GLYATL1 PE=1 SV=1
2	AFDB:Q8WU03	0.877	0.901	4.006E-38	294	0.480	0.493	Q8WU03.pdb.gz	GLYL2_HUMAN Glycine N-acyltransferase-like protein 2 OS=Homo sapiens OX=9606 GN=GLYATL2 PE=1 SV=1
3	AFDB:Q9DCY0	0.885	0.905	4.707E-36	295	0.411	0.420	Q9DCY0.pdb.gz	KEG1_MOUSE Glycine N-acyltransferase-like protein Keg1 OS=Mus musculus OX=10090 GN=Keg1 PE=1 SV=1
4	AFDB:Q2KIR7	0.888	0.908	1.167E-35	295	0.411	0.420	Q2KIR7.pdb.gz	GLYAT_BOVIN Glycine N-acyltransferase OS=Bos taurus OX=9913 GN=GLYAT PE=1 SV=2
5	AFDB:Q91XE0	0.875	0.893	1.307E-35	296	0.407	0.416	Q91XE0.pdb.gz	GLYAT_MOUSE Glycine N-acyltransferase OS=Mus musculus OX=10090 GN=Glyat PE=1 SV=1
6	AFDB:Q9Z2Y0	0.879	0.899	1.067E-34	295	0.391	0.400	Q9Z2Y0.pdb.gz	KEG1_RAT Glycine N-acyltransferase-like protein Keg1 OS=Rattus norvegicus OX=10116 GN=Keg1 PE=1 SV=2
7	PDB:7pk1A	0.874	0.915	4.474E-34	288	0.404	0.424	7pk1A.pdb.gz
8	AFDB:Q6IB77	0.844	0.861	5.854E-34	296	0.397	0.405	Q6IB77.pdb.gz	GLYAT_HUMAN Glycine N-acyltransferase OS=Homo sapiens OX=9606 GN=GLYAT PE=1 SV=3
9	AFDB:Q5FW57	0.871	0.888	6.558E-34	296	0.374	0.382	Q5FW57.pdb.gz	GLYAL_MOUSE Glycine N-acyltransferase-like protein OS=Mus musculus OX=10090 GN=Gm4952 PE=1 SV=3
10	AFDB:E9Q5L8	0.877	0.912	1.304E-28	290	0.298	0.310	E9Q5L8.pdb.gz	GLYL3_MOUSE Glycine-N-acyltransferase-like protein 3 OS=Mus musculus OX=10090 GN=Glyatl3 PE=1 SV=1
11	AFDB:Q22371	0.708	0.719	7.778E-15	297	0.169	0.172	Q22371.pdb.gz	Q22371_CAEEL Glycine N-acyltransferase-like protein OS=Caenorhabditis elegans OX=6239 GN=CELE_T10B10.4 PE=1 SV=3
12	PDB:2wpwA	0.500	0.469	1.905E-8	328	0.159	0.146	2wpwA.pdb.gz	Crystallographic and mass spectrometric analyses of a tandem GNAT protein from the clavulanic acid biosynthesis pathway.
13	PDB:2c27A	0.433	0.434	2.654E-6	301	0.106	0.106	2c27A.pdb.gz	The Substrate-Induced Conformational Change of Mycobacterium Tuberculosis Mycothiol Synthase.
14	PDB:6tdfA	0.320	0.539	2.096E-4	165	0.073	0.133	6tdfA.pdb.gz	Targeting a critical step in fungal hexosamine biosynthesis.
15	PDB:1s5kA	0.341	0.634	2.630E-4	153	0.089	0.176	1s5kA.pdb.gz	A bacterial acetyltransferase capable of regioselective N-acetylation of antibiotics and histones
16	PDB:6ygbA	0.339	0.607	2.630E-4	159	0.083	0.157	6ygbA.pdb.gz	Divergent architecture of the heterotrimeric NatC complex explains N-terminal acetylation of cognate substrates.
17	PDB:1tiqA	0.274	0.445	5.500E-4	173	0.060	0.104	1tiqA.pdb.gz	Structural and functional evidence for Bacillus subtilis PaiA as a novel N1-spermidine/spermine acetyltransferase.
18	PDB:5hgzA	0.325	0.453	7.305E-4	211	0.073	0.104	5hgzA.pdb.gz	Structure and function of human Naa60 (NatF), a Golgi-localized bi-functional acetyltransferase
19	PDB:6yugA	0.309	0.594	7.305E-4	143	0.063	0.133	6yugA.pdb.gz	Plasmodium falciparum Apicomplexan-Specific Glucosamine-6-Phosphate N -Acetyltransferase Is Key for Amino Sugar Metabolism and Asexual Blood Stage Development.
20	PDB:3fb3B	0.304	0.559	9.701E-4	149	0.076	0.154	3fb3B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q969I3	0.0	529	302	0.825	0.825	GLYL1_HUMAN Glycine N-acyltransferase-like protein 1 OS=Homo sapiens OX=9606 GN=GLYATL1 PE=1 SV=1
2	Q8WU03	1.47e-99	296	294	0.483	0.497	GLYL2_HUMAN Glycine N-acyltransferase-like protein 2 OS=Homo sapiens OX=9606 GN=GLYATL2 PE=1 SV=1
3	Q9DCY0	2.78e-81	249	295	0.404	0.414	KEG1_MOUSE Glycine N-acyltransferase-like protein Keg1 OS=Mus musculus OX=10090 GN=Keg1 PE=1 SV=1
4	Q91XE0	2.78e-80	247	296	0.397	0.405	GLYAT_MOUSE Glycine N-acyltransferase OS=Mus musculus OX=10090 GN=Glyat PE=1 SV=1
5	Q6IB77	1.58e-78	242	296	0.397	0.405	GLYAT_HUMAN Glycine N-acyltransferase OS=Homo sapiens OX=9606 GN=GLYAT PE=1 SV=3
6	Q2KIR7	1.94e-78	242	295	0.397	0.407	GLYAT_BOVIN Glycine N-acyltransferase OS=Bos taurus OX=9913 GN=GLYAT PE=1 SV=2
7	Q9Z2Y0	8.58e-78	240	295	0.394	0.403	KEG1_RAT Glycine N-acyltransferase-like protein Keg1 OS=Rattus norvegicus OX=10116 GN=Keg1 PE=1 SV=2
8	Q5FW57	2.23e-74	232	296	0.381	0.389	GLYAL_MOUSE Glycine N-acyltransferase-like protein OS=Mus musculus OX=10090 GN=Gm4952 PE=1 SV=3
9	E9Q5L8	1.70e-50	170	290	0.325	0.338	GLYL3_MOUSE Glycine-N-acyltransferase-like protein 3 OS=Mus musculus OX=10090 GN=Glyatl3 PE=1 SV=1
10	Q22371	0.24	35.0	297	0.083	0.084	Q22371_CAEEL Glycine N-acyltransferase-like protein OS=Caenorhabditis elegans OX=6239 GN=CELE_T10B10.4 PE=1 SV=3
11	D3ZEF4	0.39	35.0	1692	0.089	0.016	CUL7_RAT Cullin-7 OS=Rattus norvegicus OX=10116 GN=Cul7 PE=1 SV=1
12	Q91X17	1.3	33.1	642	0.113	0.053	UROM_MOUSE Uromodulin OS=Mus musculus OX=10090 GN=Umod PE=1 SV=1
13	Q9FIN1	2.0	32.0	261	0.060	0.069	6PGL4_ARATH Probable 6-phosphogluconolactonase 4 OS=Arabidopsis thaliana OX=3702 GN=PGL4 PE=2 SV=1
14	P28337	4.1	31.6	392	0.063	0.048	GCST_CHICK Aminomethyltransferase, mitochondrial OS=Gallus gallus OX=9031 GN=AMT PE=1 SV=2
15	Q925N1	5.2	30.8	313	0.056	0.054	SFXN4_MOUSE Sideroflexin-4 OS=Mus musculus OX=10090 GN=Sfxn4 PE=2 SV=2
16	O01546	5.5	30.8	316	0.043	0.041	O01546_CAEEL N-acetyltransferase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_F31F7.1 PE=4 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08445 FR47	1.6e+02	13.7	FR47-like protein
2	PF08444 Gly_acyl_tr_C	5.8e-32	121.1	Aralkyl acyl-CoA:amino acid N-acyltransferase, C-terminal region
3	PF06021 Gly_acyl_tr_N	4.5e-76	267.0	Aralkyl acyl-CoA:amino acid N-acyltransferase
4	PF08127 Propeptide_C1	2.5e+02	12.9	Peptidase family C1 propeptide

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000023193

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000020059	0.604	Pleckstrin and Sec7 domain containing 4
2	9593.ENSGGOP00000023089	0.604	DExD-box helicase 52
3	9593.ENSGGOP00000017038	0.602	ATP/GTP binding protein-like 2
4	9593.ENSGGOP00000010841	0.570	Adaptor-related protein complex 3, mu 1 subunit
5	9593.ENSGGOP00000005353	0.568	Belongs to the acetyltransferase family. GCN5 subfamily.
6	9593.ENSGGOP00000020086	0.553	Belongs to the acetyltransferase family. GCN5 subfamily.
7	9593.ENSGGOP00000004628	0.532	Polyamine oxidase (exo-N4-amino)
8	9593.ENSGGOP00000027220	0.529	Spermidine/spermine N1-acetyltransferase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016410	1.000	N-acyltransferase activity
GO:0005488	0.727	binding
GO:0005515	0.547	protein binding
GO:0047946	0.440	glutamine N-acyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.984	cellular process
GO:0006807	0.984	nitrogen compound metabolic process
GO:0071704	0.977	organic substance metabolic process
GO:1901564	0.950	organonitrogen compound metabolic process
GO:0044238	0.946	primary metabolic process
GO:1901605	0.836	alpha-amino acid metabolic process
GO:0009064	0.572	glutamine family amino acid metabolic process
GO:0006541	0.543	glutamine metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005739	0.964	mitochondrion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.3.1.-	1.000	Transferring groups other than amino-acyl groups.
RHEA:18469	0.440	an acyl-CoA + L-glutamine = an N(2)-acyl-L-glutamine + CoA + H(+)
EC:2.3.1.68	0.440	glutamine N-acyltransferase.

[back to server]