StarFunc result for job id A0A0U1RQI7

User Input

>input (1052 residues)
MDSSLLQAIEEIEKFFQHLSERHTEQAETPDAPEPQNCMPLTAHAEESQHESTQSKTMPP
LGSTMMTSACTNIPGTVLTQDLTMHPLKALEDLSETYSMGQKVTSFDQVKHTAGSQMTDV
TVTPKSSPTDCQKTTITASNMTISNESSQLNTPSSDQTLNESQIPALLGDQMKTLSDNQT
LCGDQVTFSSDQTLTDGHTVTSGSDETLSGGQMTTSLDLYGGQMMTSIDNQTLCGEQMTT
SSGNQAFYGRQMTTSTGNQTLCGEQMTTSTGNQALYGGQMTTSASNQTLCGEQMTTSTSN
QTLCGEQVMTSTGNQALCGGQMTTSTGNQNLYGGQMMTSTGNQTLYWGQMMTSTGNQNLC
GEQVMTSTGNQALCGGQMTTSTGNQNLYGGQMMTSTGNQTLYWGQMMTSTGNQNLCGEQV
MTSTGNQALCGGQMTTSTGNQNLCGEQVMTSTSNQTLCGEQTTTSTSNQTLCGEQVTTST
GNQALYGGQMMTSTGNQTLYWGQMMTSTGNQNLCGEQMTTSTGNQALYGGQMTTSTSNQT
LCGEQMTTPTSNQTLCGEQVTTSTGNQALYGGQITTSTSNQTLCGEQMTTSTSNQTLCGE
QVTTSTGNQALYGGQMMTSTGNQALYGGQMTTSASNQTLCGEQMTTSTSNQTLCEEQVMT
STGNQALCGEQMTTSTGNQALYGGQMTTSTSNQTLCGEQTTTSTSNQTLCGEQVTTSTGN
QALYGGQMMTSTGNQTLYWGQMMTSTGNQNLCGEQMTTSTGNQALYGGQMTTSTSNQTLC
GEQMTTPTSNQTLCGEQVTTSTGNQALYRGQITTSTSNQTLCGEQMTTSTSNQTLCGEQV
TTSTGNQALYGGQMMTSTGNQNLYGGQNMTSTDNQALYGGQMATYSGNQTLYGDQMLTLQ
VGNMTTLTDDHSLYGGYMMSHQFSSLPYPGFLCFSSSHLIQGQLPKQKTQSCQFWKNPEV
SRPYVCTYEDCKMSYSKACHLRTHMRKHTGEKPYVCDVEGCTWKFARSDELNRHKKRHTG
ERPYLCSICSKNFARSDHLKQHAKVHNIRPGL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P24587	0.067	0.087	7.894E-5	714	0.064	0.094	P24587.pdb.gz	AKAP5_RAT A-kinase anchor protein 5 OS=Rattus norvegicus OX=10116 GN=Akap5 PE=1 SV=2
2	AFDB:Q8K1S5	0.084	0.172	1.097E-4	502	0.048	0.102	Q8K1S5.pdb.gz	KLF11_MOUSE Krueppel-like factor 11 OS=Mus musculus OX=10090 GN=Klf11 PE=2 SV=3
3	AFDB:P26632	0.079	0.163	3.723E-4	511	0.051	0.106	P26632.pdb.gz	EGR1_DANRE Early growth response protein 1 OS=Danio rerio OX=7955 GN=egr1 PE=2 SV=2
4	AFDB:Q874R4	0.051	0.054	5.957E-4	973	0.136	0.147	Q874R4.pdb.gz	PFL3_SCHPO Putative cell agglutination protein pfl3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pfl3 PE=3 SV=1
5	AFDB:Q05159	0.084	0.211	9.990E-4	412	0.046	0.117	Q05159.pdb.gz	EGR2B_DANRE Early growth response protein 2b OS=Danio rerio OX=7955 GN=egr2b PE=2 SV=1
6	AFDB:P17040	0.078	0.079	1.598E-3	1043	0.040	0.040	P17040.pdb.gz	ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens OX=9606 GN=ZSCAN20 PE=1 SV=3
7	AFDB:Q9BZE0	0.081	0.160	3.554E-3	524	0.043	0.086	Q9BZE0.pdb.gz	GLIS2_HUMAN Zinc finger protein GLIS2 OS=Homo sapiens OX=9606 GN=GLIS2 PE=1 SV=2
8	AFDB:Q70ZY9	0.066	0.089	3.725E-3	737	0.045	0.064	Q70ZY9.pdb.gz	Q70ZY9_DANRE HIC1 protein OS=Danio rerio OX=7955 GN=zfHIC1 PE=2 SV=1
9	AFDB:Q9Y2X9	0.060	0.069	6.246E-3	895	0.038	0.045	Q9Y2X9.pdb.gz	ZN281_HUMAN Zinc finger protein 281 OS=Homo sapiens OX=9606 GN=ZNF281 PE=1 SV=1
10	AFDB:P47179	0.052	0.050	6.862E-3	1161	0.072	0.065	P47179.pdb.gz	DAN4_YEAST Cell wall protein DAN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DAN4 PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8CFA7	8.63e-33	132	341	0.051	0.158	KLF17_MOUSE Krueppel-like factor 17 OS=Mus musculus OX=10090 GN=Klf17 PE=1 SV=2
2	Q5JT82	4.08e-32	132	389	0.051	0.139	KLF17_HUMAN Krueppel-like factor 17 OS=Homo sapiens OX=9606 GN=KLF17 PE=1 SV=1
3	Q0IGQ2	6.35e-32	129	311	0.049	0.167	Q0IGQ2_DROME Kruppel-like factor 15 OS=Drosophila melanogaster OX=7227 GN=Klf15 PE=2 SV=2
4	Q9EPW2	3.39e-31	129	415	0.048	0.120	KLF15_MOUSE Krueppel-like factor 15 OS=Mus musculus OX=10090 GN=Klf15 PE=1 SV=1
5	Q5FVT6	4.08e-31	129	415	0.048	0.120	Q5FVT6_RAT Klf15 protein OS=Rattus norvegicus OX=10116 GN=Klf15 PE=2 SV=1
6	Q9WTQ3	4.24e-31	129	415	0.048	0.120	Q9WTQ3_RAT Kruppel-like transcription factor OS=Rattus norvegicus OX=10116 GN=Klf15 PE=2 SV=1
7	Q65ZG6	4.82e-31	127	315	0.046	0.152	KLF3_CAEEL Kruppel-like factor 3 OS=Caenorhabditis elegans OX=6239 GN=klf-3 PE=1 SV=1
8	Q9UIH9	4.86e-31	129	416	0.048	0.120	KLF15_HUMAN Krueppel-like factor 15 OS=Homo sapiens OX=9606 GN=KLF15 PE=1 SV=1
9	P46099	4.58e-30	125	358	0.045	0.131	KLF1_MOUSE Krueppel-like factor 1 OS=Mus musculus OX=10090 GN=Klf1 PE=1 SV=2
10	B0BNN2	8.94e-30	124	368	0.044	0.125	B0BNN2_RAT Klf1 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Klf1 PE=2 SV=1
11	Q9TZ64	1.68e-29	126	497	0.048	0.101	KLF1_CAEEL Kruppel-like factor 1 OS=Caenorhabditis elegans OX=6239 GN=klf-1 PE=1 SV=1
12	Q66HP1	3.12e-29	122	363	0.045	0.129	Q66HP1_RAT Klf5 protein OS=Rattus norvegicus OX=10116 GN=Klf5 PE=2 SV=1
13	E9QG09	3.77e-29	124	429	0.046	0.112	E9QG09_DANRE Krueppel-like factor 5 OS=Danio rerio OX=7955 GN=pibf1 PE=4 SV=1
14	A0A8I5ZPH7	4.10e-29	122	361	0.044	0.127	A0A8I5ZPH7_RAT Kruppel like factor 1 OS=Rattus norvegicus OX=10116 GN=Klf1 PE=4 SV=1
15	G3V6F3	4.47e-29	123	396	0.044	0.116	G3V6F3_RAT Kruppel like factor 1 OS=Rattus norvegicus OX=10116 GN=Klf1 PE=4 SV=2
16	Q13351	5.48e-29	122	362	0.044	0.127	KLF1_HUMAN Krueppel-like factor 1 OS=Homo sapiens OX=9606 GN=KLF1 PE=1 SV=1
17	F1LSL7	7.29e-29	123	443	0.045	0.106	F1LSL7_RAT Kruppel-like factor 5 OS=Rattus norvegicus OX=10116 GN=Klf5 PE=4 SV=2
18	Q9BXK1	7.66e-29	118	252	0.045	0.187	KLF16_HUMAN Krueppel-like factor 16 OS=Homo sapiens OX=9606 GN=KLF16 PE=1 SV=1
19	Q4R0P9	8.09e-29	122	428	0.045	0.110	Q4R0P9_DROME Cabut OS=Drosophila melanogaster OX=7227 GN=cbt PE=2 SV=1
20	Q8K1S5	8.39e-29	124	502	0.042	0.088	KLF11_MOUSE Krueppel-like factor 11 OS=Mus musculus OX=10090 GN=Klf11 PE=2 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07051 OCIA	89	14.5	Ovarian carcinoma immunoreactive antigen (OCIA)
2	PF00096 zf-C2H2	1.3e-08	46.0	Zinc finger, C2H2 type
3	PF13894 zf-C2H2_4	0.00021	32.9	C2H2-type zinc finger
4	PF13465 zf-H2C2_2	1.3e-07	42.9	Zinc-finger double domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9483.ENSCJAP00000044275

Rank	PPI partner	STRING score	Description
1	9483.ENSCJAP00000013283	0.602	Speckle-type POZ protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0097159	0.966	organic cyclic compound binding
GO:0003676	0.959	nucleic acid binding
GO:0043565	0.915	sequence-specific DNA binding
GO:0140110	0.661	transcription regulator activity
GO:0003700	0.643	DNA-binding transcription factor activity
GO:0003690	0.505	double-stranded DNA binding
GO:1990837	0.382	sequence-specific double-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.449	regulation of biological process
GO:0050794	0.403	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.998	nucleus
GO:0031974	0.972	membrane-enclosed lumen
GO:0043233	0.960	organelle lumen
GO:0070013	0.954	intracellular organelle lumen
GO:0031981	0.916	nuclear lumen
GO:0005654	0.891	nucleoplasm
GO:0032991	0.435	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]