StarFunc result for job id A0A140TA62

User Input

>input (436 residues)
MLYAKPPPTINGIKGLQRKERLKPAHIHLQQLTCFSITCSSTMSYSCCLPSLGCRTSCSS
RPCVPPSCHGYTLPGACNIPANVSNCNWFCEGSFNGSEKETMQFLNDRLASYLEKVRQLE
RDNAELEKLIQERSQQQEPLLCPSYQSYFKTIEELQQKILCAKAENARLVVNIDNAKLAS
DDFRSKYQTEQSLRLLVESDINSIRRILDELTLCKSDLESQVESLREELICLKKNHEEEV
NTLRSQLGDRLNVEVDTAPTVDLNQVLNETRSQYEALVETNRREVEQWFATQTEELNKQV
VSSSEQLQSCQAEIIELRRTVNALEIELQAQHNLRDSLENTLTESEAHYSSQLSQVQSLI
TNVESQLAEIRCDLERQNQEYQVLLDVRARLECEINTYRSLLESEDCKLPCNPCATTNAS
GNSCGPCGTSQKGCCN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O76011	0.733	0.733	3.994E-55	436	0.998	0.998	O76011.pdb.gz	KRT34_HUMAN Keratin, type I cuticular Ha4 OS=Homo sapiens OX=9606 GN=KRT34 PE=1 SV=3
2	AFDB:Q15323	0.618	0.645	3.731E-40	416	0.803	0.841	Q15323.pdb.gz	K1H1_HUMAN Keratin, type I cuticular Ha1 OS=Homo sapiens OX=9606 GN=KRT31 PE=1 SV=3
3	AFDB:Q92764	0.613	0.590	3.238E-32	455	0.640	0.613	Q92764.pdb.gz	KRT35_HUMAN Keratin, type I cuticular Ha5 OS=Homo sapiens OX=9606 GN=KRT35 PE=1 SV=5
4	AFDB:O76013	0.593	0.558	1.366E-31	467	0.638	0.595	O76013.pdb.gz	KRT36_HUMAN Keratin, type I cuticular Ha6 OS=Homo sapiens OX=9606 GN=KRT36 PE=1 SV=1
5	AFDB:Q14532	0.632	0.618	3.015E-30	448	0.619	0.603	Q14532.pdb.gz	K1H2_HUMAN Keratin, type I cuticular Ha2 OS=Homo sapiens OX=9606 GN=KRT32 PE=1 SV=3
6	AFDB:Q6A162	0.609	0.615	1.101E-29	431	0.589	0.596	Q6A162.pdb.gz	K1C40_HUMAN Keratin, type I cytoskeletal 40 OS=Homo sapiens OX=9606 GN=KRT40 PE=1 SV=2
7	AFDB:Q6A163	0.494	0.447	3.483E-28	491	0.544	0.483	Q6A163.pdb.gz	K1C39_HUMAN Keratin, type I cytoskeletal 39 OS=Homo sapiens OX=9606 GN=KRT39 PE=1 SV=2
8	AFDB:O76015	0.561	0.540	4.645E-28	456	0.564	0.539	O76015.pdb.gz	KRT38_HUMAN Keratin, type I cuticular Ha8 OS=Homo sapiens OX=9606 GN=KRT38 PE=1 SV=3
9	AFDB:Q6IFW3	0.572	0.523	2.808E-27	481	0.521	0.472	Q6IFW3.pdb.gz	K1C39_RAT Keratin, type I cytoskeletal 39 OS=Rattus norvegicus OX=10116 GN=Krt39 PE=3 SV=1
10	AFDB:Q6PVZ1	0.439	0.416	7.700E-22	467	0.463	0.433	Q6PVZ1.pdb.gz	K1C14_CHICK Keratin, type I cytoskeletal 14 OS=Gallus gallus OX=9031 GN=KRT14 PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O76009	0.0	698	404	0.810	0.874	KT33A_HUMAN Keratin, type I cuticular Ha3-I OS=Homo sapiens OX=9606 GN=KRT33A PE=2 SV=2
2	O76011	0.0	880	436	0.998	0.998	KRT34_HUMAN Keratin, type I cuticular Ha4 OS=Homo sapiens OX=9606 GN=KRT34 PE=1 SV=3
3	O76013	0.0	533	467	0.626	0.585	KRT36_HUMAN Keratin, type I cuticular Ha6 OS=Homo sapiens OX=9606 GN=KRT36 PE=1 SV=1
4	Q14525	0.0	696	404	0.812	0.876	KT33B_HUMAN Keratin, type I cuticular Ha3-II OS=Homo sapiens OX=9606 GN=KRT33B PE=1 SV=3
5	Q14532	0.0	521	448	0.608	0.592	K1H2_HUMAN Keratin, type I cuticular Ha2 OS=Homo sapiens OX=9606 GN=KRT32 PE=1 SV=3
6	Q15323	0.0	691	416	0.800	0.839	K1H1_HUMAN Keratin, type I cuticular Ha1 OS=Homo sapiens OX=9606 GN=KRT31 PE=1 SV=3
7	Q92764	0.0	521	455	0.633	0.607	KRT35_HUMAN Keratin, type I cuticular Ha5 OS=Homo sapiens OX=9606 GN=KRT35 PE=1 SV=5
8	B1AQ75	1.03e-179	511	473	0.610	0.562	KRT36_MOUSE Keratin, type I cuticular Ha6 OS=Mus musculus OX=10090 GN=Krt36 PE=1 SV=1
9	Q6A162	3.33e-169	483	431	0.589	0.596	K1C40_HUMAN Keratin, type I cytoskeletal 40 OS=Homo sapiens OX=9606 GN=KRT40 PE=1 SV=2
10	O76015	1.32e-164	473	456	0.550	0.526	KRT38_HUMAN Keratin, type I cuticular Ha8 OS=Homo sapiens OX=9606 GN=KRT38 PE=1 SV=3
11	O76014	2.50e-162	466	449	0.539	0.523	KRT37_HUMAN Keratin, type I cuticular Ha7 OS=Homo sapiens OX=9606 GN=KRT37 PE=1 SV=3
12	Q6A163	5.47e-144	421	491	0.511	0.454	K1C39_HUMAN Keratin, type I cytoskeletal 39 OS=Homo sapiens OX=9606 GN=KRT39 PE=1 SV=2
13	Q6IFW3	1.84e-141	415	481	0.495	0.449	K1C39_RAT Keratin, type I cytoskeletal 39 OS=Rattus norvegicus OX=10116 GN=Krt39 PE=3 SV=1
14	Q6PVZ1	1.51e-129	384	467	0.429	0.400	K1C14_CHICK Keratin, type I cytoskeletal 14 OS=Gallus gallus OX=9031 GN=KRT14 PE=2 SV=1
15	Q6IFU8	1.36e-128	380	433	0.440	0.443	K1C17_RAT Keratin, type I cytoskeletal 17 OS=Rattus norvegicus OX=10116 GN=Krt17 PE=1 SV=1
16	Q04695	1.85e-128	380	432	0.429	0.433	K1C17_HUMAN Keratin, type I cytoskeletal 17 OS=Homo sapiens OX=9606 GN=KRT17 PE=1 SV=2
17	Q9QWL7	2.42e-128	379	433	0.440	0.443	K1C17_MOUSE Keratin, type I cytoskeletal 17 OS=Mus musculus OX=10090 GN=Krt17 PE=1 SV=3
18	P02533	9.30e-127	377	472	0.424	0.392	K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens OX=9606 GN=KRT14 PE=1 SV=4
19	Q6IFV1	2.34e-126	376	485	0.422	0.379	K1C14_RAT Keratin, type I cytoskeletal 14 OS=Rattus norvegicus OX=10116 GN=Krt14 PE=2 SV=1
20	P08727	5.11e-126	372	400	0.399	0.435	K1C19_HUMAN Keratin, type I cytoskeletal 19 OS=Homo sapiens OX=9606 GN=KRT19 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04513 Baculo_PEP_C	7.4e+02	11.6	Baculovirus polyhedron envelope protein, PEP, C terminus
2	PF00038 Filament	2.3e-101	351.1	Intermediate filament protein
3	PF12827 Peroxin-22	1.4e+02	13.8	Peroxisomal biogenesis protein family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000377570

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000368447	0.719	GPALPP motifs containing 1
2	9606.ENSP00000278520	0.690	Coiled-coil domain containing 82
3	9606.ENSP00000355302	0.641	Keratin-associated protein 1-5
4	9606.ENSP00000375237	0.628	Keratin associated protein 2-3
5	9606.ENSP00000419101	0.582	Voltage-dependent calcium channel subunit alpha-2/delta-3
6	9606.ENSP00000246662	0.547	Keratin, type I cytoskeletal 9
7	9606.ENSP00000251646	0.540	Keratin, type I cuticular Ha3-II
8	9606.ENSP00000301653	0.533	Keratin, type I cytoskeletal 16
9	9606.ENSP00000308452	0.533	Keratin, type I cytoskeletal 17
10	9606.ENSP00000334798	0.531	Keratin, type I cytoskeletal 26
11	9606.ENSP00000167588	0.528	Keratin, type I cytoskeletal 20
12	9606.ENSP00000254043	0.528	Keratin, type I cytoskeletal 15
13	9606.ENSP00000373487	0.528	Keratin, type I cytoskeletal 18
14	9606.ENSP00000301656	0.525	Keratin, type I cytoskeletal 27
15	9606.ENSP00000167586	0.520	Keratin, type I cytoskeletal 14
16	9606.ENSP00000310573	0.520	Keratin, type I cytoskeletal 25
17	9606.ENSP00000375430	0.519	Keratin-associated protein 3-1
18	9606.ENSP00000269576	0.516	Keratin, type I cytoskeletal 10
19	9606.ENSP00000251643	0.514	Keratin, type I cytoskeletal 12
20	9606.ENSP00000264651	0.514	Keratin, type I cytoskeletal 24

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005198	0.985	structural molecule activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032502	0.990	developmental process
GO:0048856	0.956	anatomical structure development
GO:0008544	0.931	epidermis development
GO:0009987	0.500	cellular process
GO:0032501	0.329	multicellular organismal process
GO:0050789	0.305	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0005576	0.995	extracellular region
GO:0005615	0.990	extracellular space
GO:0043226	0.981	organelle
GO:0043232	0.931	intracellular non-membrane-bounded organelle
GO:0043227	0.890	membrane-bounded organelle
GO:0043230	0.861	extracellular organelle
GO:0070062	0.852	extracellular exosome
GO:0005856	0.362	cytoskeleton
GO:0045111	0.309	intermediate filament cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]