StarFunc result for job id A0A1B0GTG8

User Input

>input (36 residues)
MWPLWHAPSSGEANVTLAMALFTILTSIYFFNKAQQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9SR77	0.839	0.105	4.454	309	0.278	0.032	Q9SR77.pdb.gz	HBPL1_ARATH Heme-binding-like protein At3g10130, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At3g10130 PE=1 SV=1
2	AFDB:Q0DJ33	0.547	0.077	6.366	380	0.250	0.024	Q0DJ33.pdb.gz	GPA1_ORYSJ Guanine nucleotide-binding protein alpha-1 subunit OS=Oryza sativa subsp. japonica OX=39947 GN=GPA1 PE=1 SV=2
3	AFDB:B7ZQJ9	0.626	0.029	6.961	993	0.222	0.008	B7ZQJ9.pdb.gz	GT2D1_XENLA General transcription factor II-I repeat domain-containing protein 1 OS=Xenopus laevis OX=8355 GN=gtf2ird1 PE=1 SV=1
4	AFDB:A9V7T9	0.508	0.043	9.949	628	0.278	0.016	A9V7T9.pdb.gz	A9V7T9_MONBE BZIP domain-containing protein OS=Monosiga brevicollis OX=81824 GN=MONBRDRAFT_10973 PE=1 SV=1
5	AFDB:Q402F3	0.504	0.074	9.949	294	0.111	0.014	Q402F3.pdb.gz	TOM3_TOBAC Tobamovirus multiplication protein 3 OS=Nicotiana tabacum OX=4097 GN=TOM3 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NZ01	8.7	24.6	308	0.278	0.032	TECR_HUMAN Very-long-chain enoyl-CoA reductase OS=Homo sapiens OX=9606 GN=TECR PE=1 SV=1
2	M0R2N5	9.9	24.6	346	0.278	0.029	M0R2N5_HUMAN very-long-chain enoyl-CoA reductase OS=Homo sapiens OX=9606 GN=TECR PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11676 DUF3272	2.2e+02	13.5	Protein of unknown function (DUF3272)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0008152	0.423	metabolic process
GO:0009987	0.320	cellular process
GO:0071704	0.306	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043229	0.998	intracellular organelle
GO:0043231	0.983	intracellular membrane-bounded organelle
GO:0005783	0.875	endoplasmic reticulum
GO:0016020	0.823	membrane
GO:0032991	0.715	protein-containing complex
GO:0043228	0.547	non-membrane-bounded organelle
GO:0043232	0.503	intracellular non-membrane-bounded organelle
GO:0034357	0.489	photosynthetic membrane
GO:0030096	0.389	plasma membrane-derived thylakoid photosystem II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name