StarFunc result for job id A0A1B0GTI8

User Input

>input (187 residues)
MPGGLEKTCHQCISKIASNACFVVVLCAFLALPLSMTFIGMKFLEDCPIQPLIPLYLLVG
GIVGTLKVSLLLYDSTRMRRLLSKAVVIDDDDDDEYPWRQNAHRYYIHLLLSLFLFLWFI
LGNYWVFSVYLPDFLPPFQQPQDYCDKTLYLFAVGVLALSHTVLVLLLLCSGCVYLCSRW
RLAADED

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q27GU4	0.594	0.336	1.138E-6	348	0.198	0.106	Q27GU4.pdb.gz	Q27GU4_CAEEL MARVEL domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_F41C3.8 PE=1 SV=1
2	AFDB:Q93Z92	0.508	0.271	3.367E-3	390	0.160	0.077	Q93Z92.pdb.gz	RING4_ARATH E3 ubiquitin-protein ligase At4g11680 OS=Arabidopsis thaliana OX=3702 GN=At4g11680 PE=2 SV=1
3	AFDB:Q8GUU2	0.492	0.295	9.886E-3	359	0.203	0.106	Q8GUU2.pdb.gz	RIE1_ARATH E3 ubiquitin protein ligase RIE1 OS=Arabidopsis thaliana OX=3702 GN=RIE1 PE=2 SV=1
4	AFDB:Q9LN71	0.543	0.273	1.389E-2	408	0.144	0.066	Q9LN71.pdb.gz	RING1_ARATH E3 ubiquitin-protein ligase At1g12760 OS=Arabidopsis thaliana OX=3702 GN=At1g12760 PE=1 SV=1
5	AFDB:Q93YQ5	0.504	0.275	2.902E-2	379	0.134	0.066	Q93YQ5.pdb.gz	Q93YQ5_ARATH RING/U-box superfamily protein OS=Arabidopsis thaliana OX=3702 GN=T20K12.80 PE=1 SV=1
6	AFDB:Q9C9X1	0.546	0.333	4.078E-2	343	0.187	0.102	Q9C9X1.pdb.gz	Q9C9X1_ARATH At1g68070 OS=Arabidopsis thaliana OX=3702 GN=At1g68070 PE=1 SV=1
7	AFDB:P53747	0.293	0.253	1.994E-1	219	0.107	0.091	P53747.pdb.gz	YN8Z_YEAST Uncharacterized vacuolar membrane protein YNR061C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YNR061C PE=1 SV=1
8	AFDB:Q8LES9	0.424	0.261	3.139E-1	343	0.193	0.105	Q8LES9.pdb.gz	Q8LES9_ARATH RING/U-box superfamily protein OS=Arabidopsis thaliana OX=3702 GN=MDA7.1 PE=1 SV=1
9	AFDB:Q8GYT9	0.377	0.229	3.515E-1	358	0.123	0.064	Q8GYT9.pdb.gz	SIS3_ARATH E3 ubiquitin-protein ligase SIS3 OS=Arabidopsis thaliana OX=3702 GN=SIS3 PE=2 SV=2
10	AFDB:Q9NYW5	0.421	0.277	6.197E-1	299	0.118	0.074	Q9NYW5.pdb.gz	TA2R4_HUMAN Taste receptor type 2 member 4 OS=Homo sapiens OX=9606 GN=TAS2R4 PE=1 SV=1
11	PDB:7cz5R	0.352	0.260	1.047	269	0.070	0.048	7cz5R.pdb.gz	Structural basis for activation of the growth hormone-releasing hormone receptor.
12	PDB:7vqxR	0.338	0.191	1.390	361	0.123	0.064	7vqxR.pdb.gz	A distinctive ligand recognition mechanism by the human vasoactive intestinal polypeptide receptor 2.
13	PDB:7qskJ	0.153	0.161	1.845	175	0.075	0.080	7qskJ.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.
14	PDB:7rycO	0.312	0.222	1.845	285	0.123	0.081	7rycO.pdb.gz	The oxytocin signaling complex reveals a molecular switch for cation dependence.
15	PDB:7zw1B	0.253	0.166	2.187	316	0.096	0.057	7zw1B.pdb.gz
16	PDB:7zw1A	0.338	0.217	2.314	317	0.091	0.054	7zw1A.pdb.gz
17	PDB:6gxnv	0.248	0.164	2.449	348	0.075	0.040	6gxnv.pdb.gz	Visualization of translation termination intermediates trapped by the Apidaecin 137 peptide during RF3-mediated recycling of RF1.
18	PDB:7finR	0.368	0.204	2.449	380	0.123	0.061	7finR.pdb.gz	Structural insights into multiplexed pharmacological actions of tirzepatide and peptide 20 at the GIP, GLP-1 or glucagon receptors.
19	PDB:7ejaR	0.342	0.252	2.592	269	0.080	0.056	7ejaR.pdb.gz	Structural insights into ligand recognition, activation, and signaling of the alpha 2A adrenergic receptor.
20	PDB:7e9hR	0.254	0.094	2.743	766	0.166	0.040	7e9hR.pdb.gz	Structures of G i -bound metabotropic glutamate receptors mGlu2 and mGlu4.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q27GU4	0.012	38.1	348	0.203	0.109	Q27GU4_CAEEL MARVEL domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_F41C3.8 PE=1 SV=1
2	Q8LES9	0.023	37.0	343	0.150	0.082	Q8LES9_ARATH RING/U-box superfamily protein OS=Arabidopsis thaliana OX=3702 GN=MDA7.1 PE=1 SV=1
3	P0ABB8	0.33	33.9	898	0.214	0.045	ATMA_ECOLI Magnesium-transporting ATPase, P-type 1 OS=Escherichia coli (strain K12) OX=83333 GN=mgtA PE=1 SV=1
4	Q9ESG4	5.0	29.6	222	0.075	0.063	CLTRN_MOUSE Collectrin OS=Mus musculus OX=10090 GN=Cltrn PE=1 SV=1
5	Q93YQ5	5.2	30.0	379	0.070	0.034	Q93YQ5_ARATH RING/U-box superfamily protein OS=Arabidopsis thaliana OX=3702 GN=T20K12.80 PE=1 SV=1
6	Q8CGQ1	6.0	30.0	754	0.118	0.029	Q8CGQ1_MOUSE ADAM6 OS=Mus musculus OX=10090 GN=Adam6a PE=2 SV=1
7	P35560	6.3	29.6	391	0.075	0.036	KCNJ1_RAT ATP-sensitive inward rectifier potassium channel 1 OS=Rattus norvegicus OX=10116 GN=Kcnj1 PE=2 SV=1
8	O13931	6.9	27.7	60	0.080	0.250	ATP18_SCHPO ATP synthase subunit J, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=atp18 PE=3 SV=1
9	O88335	7.1	29.6	372	0.075	0.038	KCNJ1_MOUSE ATP-sensitive inward rectifier potassium channel 1 OS=Mus musculus OX=10090 GN=Kcnj1 PE=2 SV=1
10	P9WJU3	7.5	29.6	962	0.123	0.024	MMPL9_MYCTU Probable transport protein MmpL9 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=mmpL9 PE=1 SV=1
11	P53049	8.2	29.6	1477	0.096	0.012	YOR1_YEAST Oligomycin resistance ATP-dependent permease YOR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YOR1 PE=1 SV=1
12	Q9DA75	8.3	29.6	534	0.150	0.052	NLS1_MOUSE Sodium-dependent lysophosphatidylcholine symporter 1 OS=Mus musculus OX=10090 GN=Mfsd2a PE=1 SV=1
13	Q8T043	9.0	29.3	894	0.064	0.013	Q8T043_DROME Chaski, isoform A OS=Drosophila melanogaster OX=7227 GN=chk PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 52644.XP_010581732.1

Rank	PPI partner	STRING score	Description
1	52644.XP_010563837.1	0.716	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 100% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
2	52644.XP_010577281.1	0.715	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 EST, 10 Proteins
3	52644.XP_010571043.1	0.714	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 ESTs, 31 Proteins
4	52644.XP_010580574.1	0.714	TRAF-type zinc finger domain-containing protein 1
5	52644.XP_010563071.1	0.704	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 35 ESTs, 19 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
6	52644.XP_010581724.1	0.655	dnaJ homolog subfamily C member 15
7	52644.XP_010575633.1	0.639	DNA fragmentation factor subunit alpha
8	52644.XP_010572107.1	0.636	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 mRNAs, 3 ESTs, 7 Proteins, and 54% coverage of the annotated genomic feature by RNAseq alignments
9	52644.XP_010561117.1	0.600	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 9 Proteins, and 81% coverage of the annotated genomic feature by RNAseq alignments
10	52644.XP_010565187.1	0.599	Myelin protein P0
11	52644.XP_010561192.1	0.583	All-trans-retinol 13,14-reductase
12	52644.XP_010583964.1	0.583	Putative all-trans-retinol 13,14-reductase
13	52644.XP_010579351.1	0.577	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments
14	52644.XP_010581692.1	0.535	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 mRNAs, 54 ESTs, 17 Proteins, and 92% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
15	52644.XP_010571519.1	0.517	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 Proteins
16	52644.XP_010579706.1	0.513	Zinc finger and BTB domain-containing protein 44 isoform X1
17	52644.XP_010575858.1	0.507	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 11 ESTs, 7 Proteins, and 93% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
18	52644.XP_010573126.1	0.504	Protein FAM161A
19	52644.XP_010569685.1	0.502	Nuclear receptor subfamily 0 group B member 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.996	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	0.995	intracellular organelle
GO:0043231	0.994	intracellular membrane-bounded organelle
GO:0016020	0.989	membrane
GO:0005737	0.886	cytoplasm
GO:0012505	0.815	endomembrane system
GO:0031090	0.800	organelle membrane
GO:0005886	0.721	plasma membrane
GO:0098588	0.417	bounding membrane of organelle
GO:0098852	0.412	lytic vacuole membrane
GO:0005764	0.391	lysosome
GO:0005765	0.353	lysosomal membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]