StarFunc result for job id A0A1B0GTS1

User Input

>input (333 residues)
MASQNTEQEYEAKLAPSVGGEPTSGGPSGSSPDPNPDSSEVLDRHEDQAMSQDPGSQDNS
PPEDRNQRVVNVEDNHNLFRLSFPRKLWTIVEEDTFKSVSWNDDGDAVIIDKDLFQREVL
QRKGAERIFKTDNLTSFIRQLNLYGFCKTRPSNSPGNKKMMIYCNSNFQRDKPRLLENIQ
RKDALRNTAQQATRVPTPKRKNLVATRRSLRIYHINARKEAIKMCQQGAPSVQGPSGTQS
FRRSGMWSKKSATRHPLGNGPPQEPNGPSWEGTSGNVTFTSSATTWMEGTGILSSLVYSD
NGSVMSLYNICYYALLASLSVMSPNEPSDDEEE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UBD0	0.325	0.259	1.234E-14	423	0.246	0.194	Q9UBD0.pdb.gz	HSFX1_HUMAN Heat shock transcription factor, X-linked OS=Homo sapiens OX=9606 GN=HSFX1 PE=1 SV=1
2	AFDB:Q96LI6	0.320	0.268	8.365E-14	401	0.231	0.192	Q96LI6.pdb.gz	HSFY1_HUMAN Heat shock transcription factor, Y-linked OS=Homo sapiens OX=9606 GN=HSFY1 PE=1 SV=1
3	AFDB:P22121	0.276	0.138	2.030E-9	677	0.225	0.111	P22121.pdb.gz	HSF_KLULA Heat shock transcription factor OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=HSF PE=1 SV=1
4	AFDB:P10961	0.290	0.125	3.492E-7	833	0.201	0.080	P10961.pdb.gz	HSF_YEAST Heat shock transcription factor OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HSF1 PE=1 SV=1
5	AFDB:Q8MRR9	0.286	0.164	2.216E-6	600	0.162	0.090	Q8MRR9.pdb.gz	Q8MRR9_DROME AT27686p OS=Drosophila melanogaster OX=7227 GN=comr PE=2 SV=1
6	AFDB:B0ZTD4	0.169	0.131	4.381E-3	463	0.150	0.108	B0ZTD4.pdb.gz	B0ZTD4_HUMAN Forkhead box A2 OS=Homo sapiens OX=9606 GN=FOXA2 PE=4 SV=1
7	AFDB:O73783	0.161	0.133	5.705E-3	424	0.189	0.149	O73783.pdb.gz
8	AFDB:Q96HH9	0.120	0.102	5.705E-3	432	0.144	0.111	Q96HH9.pdb.gz	GRM2B_HUMAN GRAM domain-containing protein 2B OS=Homo sapiens OX=9606 GN=GRAMD2B PE=1 SV=1
9	AFDB:Q9QY14	0.192	0.215	1.179E-2	288	0.135	0.156	Q9QY14.pdb.gz	FOXE3_MOUSE Forkhead box protein E3 OS=Mus musculus OX=10090 GN=Foxe3 PE=1 SV=1
10	AFDB:Q9DE25	0.207	0.157	2.135E-2	476	0.144	0.101	Q9DE25.pdb.gz	FXC1A_DANRE Forkhead box C1-A OS=Danio rerio OX=7955 GN=foxc1a PE=2 SV=1
11	PDB:4yrvA	0.108	0.122	4.762E-1	288	0.060	0.069	4yrvA.pdb.gz	Structural insights into HetR-PatS interaction involved in cyanobacterial pattern formation
12	PDB:1u02A	0.131	0.178	6.201E-1	229	0.045	0.066	1u02A.pdb.gz	Crystal structure of trehalose-6-phosphate phosphatase-related protein: biochemical and biological implications.
13	PDB:5gvxA	0.125	0.111	6.201E-1	386	0.030	0.026	5gvxA.pdb.gz	Structural insight into dephosphorylation by trehalose 6-phosphate phosphatase (OtsB2) from Mycobacterium tuberculosis.
14	PDB:4v8sAY	0.142	0.129	6.624E-1	376	0.039	0.035	4v8sAY.pdb.gz	Structural and Functional Analyses of the Interaction of Archaeal RNA Polymerase with DNA.
15	PDB:3zqeB	0.087	0.106	7.076E-1	248	0.051	0.069	3zqeB.pdb.gz	Crystal Structure of Prgi-Sipd: Insight Into a Secretion Competent State of the Type Three Secretion System Needle Tip and its Interaction with Host Ligands
16	PDB:7db7B	0.122	0.059	8.074E-1	836	0.048	0.019	7db7B.pdb.gz	Re-discovery of PF-3845 as a new chemical scaffold inhibiting phenylalanyl-tRNA synthetase in Mycobacterium tuberculosis .
17	PDB:2r5cB	0.152	0.128	1.051	419	0.054	0.043	2r5cB.pdb.gz	Structural insight into the mechanism of substrate specificity of aedes kynurenine aminotransferase.
18	PDB:6dk3A	0.141	0.117	1.051	423	0.054	0.043	6dk3A.pdb.gz
19	PDB:5iy6K	0.112	0.222	1.200	117	0.039	0.111	5iy6K.pdb.gz	Near-atomic resolution visualization of human transcription promoter opening.
20	PDB:3pcoB	0.133	0.063	1.462	795	0.039	0.016	3pcoB.pdb.gz	Idiosyncrasy and identity in the prokaryotic phe-system: crystal structure of E. coli phenylalanyl-tRNA synthetase complexed with phenylalanine and AMP.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96LI6	1.11e-28	116	401	0.186	0.155	HSFY1_HUMAN Heat shock transcription factor, Y-linked OS=Homo sapiens OX=9606 GN=HSFY1 PE=1 SV=1
2	Q9UBD0	9.74e-23	100	423	0.138	0.109	HSFX1_HUMAN Heat shock transcription factor, X-linked OS=Homo sapiens OX=9606 GN=HSFX1 PE=1 SV=1
3	Q4G112	5.97e-15	77.8	596	0.141	0.079	HSF5_HUMAN Heat shock factor protein 5 OS=Homo sapiens OX=9606 GN=HSF5 PE=2 SV=3
4	A4QNW9	5.85e-14	74.3	416	0.138	0.111	A4QNW9_DANRE Heat shock factor protein 5 OS=Danio rerio OX=7955 GN=hsf5 PE=2 SV=1
5	Q02953	5.78e-12	68.9	609	0.126	0.069	HSF_SCHPO Heat shock factor protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hsf1 PE=1 SV=2
6	G5EFT5	1.75e-11	67.4	671	0.144	0.072	HSF1_CAEEL Heat shock transcription factor hsf-1 OS=Caenorhabditis elegans OX=6239 GN=hsf-1 PE=1 SV=1
7	J9VHZ9	3.10e-11	66.6	771	0.117	0.051	HSF_CRYNH Heat shock transcription factor OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=HSF1 PE=1 SV=1
8	F5HGI6	5.36e-11	65.9	783	0.117	0.050	F5HGI6_CRYNB HSF-type DNA-binding domain-containing protein OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) OX=283643 GN=CNBB5560 PE=3 SV=1
9	Q5KMX8	5.36e-11	65.9	783	0.117	0.050	HSF_CRYNJ Heat shock transcription factor OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=HSF1 PE=1 SV=1
10	A0A060W590	9.35e-11	65.1	503	0.126	0.083	A0A060W590_ONCMY HSF-type DNA-binding domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00066731001 PE=3 SV=1
11	Q76M54	9.66e-11	65.1	501	0.123	0.082	Q76M54_ONCMY Heat shock transcription factor 1 isoform a OS=Oncorhynchus mykiss OX=8022 GN=HSF1 PE=2 SV=1
12	Q8AWA0	1.02e-10	64.7	511	0.126	0.082	Q8AWA0_ONCMY Heat shock factor 2 OS=Oncorhynchus mykiss OX=8022 GN=hsf2 PE=2 SV=1
13	G0SB31	1.07e-10	65.1	765	0.123	0.054	SKN7_CHATD Transcription factor SKN7 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) OX=759272 GN=SKN7 PE=1 SV=1
14	P22121	2.50e-10	63.9	677	0.114	0.056	HSF_KLULA Heat shock transcription factor OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=HSF PE=1 SV=1
15	Q76M53	2.61e-10	63.5	513	0.141	0.092	Q76M53_ONCMY Heat shock transcription factor 1 isoform b OS=Oncorhynchus mykiss OX=8022 GN=HSF1 PE=2 SV=1
16	Q90XA8	2.74e-10	63.5	489	0.114	0.078	Q90XA8_DANRE Heat shock factor Hsf2 OS=Danio rerio OX=7955 GN=zfHSF2 PE=2 SV=1
17	P22813	3.19e-10	63.5	691	0.108	0.052	HSF_DROME Heat shock factor protein OS=Drosophila melanogaster OX=7227 GN=Hsf PE=1 SV=1
18	F6P697	5.29e-10	62.8	523	0.132	0.084	F6P697_DANRE Heat shock factor protein 1 isoform X1 OS=Danio rerio OX=7955 GN=HSF PE=1 SV=1
19	I1MPZ9	5.44e-10	62.0	348	0.129	0.124	I1MPZ9_SOYBN HSF-type DNA-binding domain-containing protein OS=Glycine max OX=3847 GN=GLYMA_16G196200 PE=3 SV=1
20	Q1LXV0	7.02e-10	62.4	497	0.132	0.089	Q1LXV0_DANRE Heat shock factor protein 1 OS=Danio rerio OX=7955 GN=HSF PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00447 HSF_DNA-bind	4.2e-21	86.7	HSF-type DNA-binding

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003805197.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003820964.2	0.619	Heat shock factor-binding protein 1
2	9597.XP_008949701.1	0.569	Mucin 19, oligomeric
3	9597.XP_003826838.1	0.567	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: deleted 2 bases in 1 codon
4	9597.XP_003827942.1	0.567	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 4 Proteins, and 19% coverage of the annotated genomic feature by RNAseq alignments
5	9597.XP_003832079.1	0.567	Heat shock protein HSP 90-beta-like
6	9597.XP_008956956.1	0.567	Heat shock protein 90 alpha family class B member 1
7	9597.XP_008957357.1	0.567	Heat shock protein 90 alpha family class A member 1
8	9597.XP_008966268.1	0.567	TNF receptor associated protein 1
9	9597.XP_003806806.1	0.540	Belongs to the heat shock protein 70 family.
10	9597.XP_003819237.1	0.540	Heat shock 70 kDa protein 13
11	9597.XP_003821426.1	0.540	Heat shock protein family A (Hsp70) member 12B
12	9597.XP_003825672.2	0.540	Heat shock 70 kDa protein 12A isoform X1
13	9597.XP_003831596.1	0.540	Belongs to the heat shock protein 70 family.
14	9597.XP_003831655.1	0.540	Heat shock-related 70 kDa protein 2
15	9597.XP_003831833.2	0.540	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 204 ESTs, 5 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments
16	9597.XP_008950000.1	0.540	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: inserted 2 bases in 2 codons
17	9597.XP_008955414.1	0.540	Heat shock 70 kDa protein 1
18	9597.XP_008971636.1	0.540	Belongs to the heat shock protein 70 family.
19	9597.XP_003829266.1	0.522	Heat shock protein family A (Hsp70) member 9
20	9597.XP_003832615.1	0.507	Heat shock protein 90 beta family member 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043565	1.000	sequence-specific DNA binding
GO:0003690	0.966	double-stranded DNA binding
GO:1990837	0.946	sequence-specific double-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.985	biological regulation
GO:0010468	0.982	regulation of gene expression
GO:0050794	0.975	regulation of cellular process
GO:0051171	0.922	regulation of nitrogen compound metabolic process
GO:0080090	0.919	regulation of primary metabolic process
GO:0031323	0.897	regulation of cellular metabolic process
GO:0009987	0.861	cellular process
GO:0031326	0.805	regulation of cellular biosynthetic process
GO:0010556	0.804	regulation of macromolecule biosynthetic process
GO:0048518	0.783	positive regulation of biological process
GO:1903506	0.765	regulation of nucleic acid-templated transcription
GO:0050896	0.685	response to stimulus
GO:0006355	0.572	regulation of DNA-templated transcription
GO:0048523	0.531	negative regulation of cellular process
GO:0048522	0.458	positive regulation of cellular process
GO:0006950	0.401	response to stress
GO:0009892	0.322	negative regulation of metabolic process
GO:0031324	0.309	negative regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.996	intracellular organelle lumen
GO:0031981	0.984	nuclear lumen
GO:0005737	0.965	cytoplasm
GO:0005654	0.688	nucleoplasm
GO:0005829	0.601	cytosol
GO:0016020	0.448	membrane
GO:0043232	0.333	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]