StarFunc result for job id A0A1B0GUA7

User Input

>input (166 residues)
MLPLLIICLLPAIEGKNCLRCWPELSALIDYDLQILWVTPGPPTELSQNRDHLEEETAKF
FTQVHQAIKTLRDDKTVLLEEIYTHKNLFTERLNKISDGLKEKDIQSTLKVTSCADCRTH
FLSCNDPTFCPARNRRTSLWAVSLSSALLLAIAGDVSFTGKGRRRQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q07508	0.264	0.192	2.089E-1	261	0.199	0.126	Q07508.pdb.gz	LUC7_YEAST Protein LUC7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LUC7 PE=1 SV=1
2	AFDB:H0YB37	0.248	0.252	2.371E-1	163	0.096	0.098	H0YB37.pdb.gz	H0YB37_HUMAN Tetratricopeptide repeat domain 1 (Fragment) OS=Homo sapiens OX=9606 GN=TTC1 PE=1 SV=1
3	AFDB:Q9FWA6	0.173	0.051	2.526E-1	903	0.133	0.024	Q9FWA6.pdb.gz	PP207_ARATH Pentatricopeptide repeat-containing protein At3g02330, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PCMP-E90 PE=2 SV=2
4	PDB:5n9jV	0.242	0.337	3.171E-1	99	0.120	0.202	5n9jV.pdb.gz
5	AFDB:Q57YB9	0.212	0.049	3.694E-1	1028	0.133	0.021	Q57YB9.pdb.gz	Q57YB9_TRYB2 BTB domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.13M20.230 PE=4 SV=1
6	AFDB:Q84VW5	0.207	0.221	4.193E-1	151	0.114	0.126	Q84VW5.pdb.gz	MED32_ARATH Mediator of RNA polymerase II transcription subunit 32 OS=Arabidopsis thaliana OX=3702 GN=MED32 PE=1 SV=1
7	AFDB:Q94BS8	0.162	0.210	4.760E-1	119	0.096	0.134	Q94BS8.pdb.gz	EF4L2_ARATH Protein ELF4-LIKE 2 OS=Arabidopsis thaliana OX=3702 GN=EFL2 PE=2 SV=1
8	PDB:2jowA	0.297	0.516	5.263E-1	83	0.090	0.181	2jowA.pdb.gz
9	AFDB:P95434	0.247	0.429	5.403E-1	85	0.108	0.212	P95434.pdb.gz	SCTF_PSEAE Type 3 secretion system needle filament protein OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=sctF PE=1 SV=3
10	PDB:7sk8A	0.295	0.186	5.607E-1	306	0.127	0.069	7sk8A.pdb.gz	Structures of atypical chemokine receptor 3 reveal the basis for its promiscuity and signaling bias.
11	AFDB:Q01068	0.276	0.219	5.756E-1	224	0.157	0.116	Q01068.pdb.gz	ESM3_DROME Enhancer of split m3 protein OS=Drosophila melanogaster OX=7227 GN=E(spl)m3-HLH PE=1 SV=1
12	AFDB:Q9LIE7	0.136	0.042	6.132E-1	820	0.084	0.017	Q9LIE7.pdb.gz	PP246_ARATH Pentatricopeptide repeat-containing protein At3g22150, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PCMP-E95 PE=2 SV=1
13	PDB:7enah	0.247	0.224	6.781E-1	190	0.145	0.126	7enah.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
14	PDB:7vvuV	0.175	0.247	6.781E-1	113	0.108	0.159	7vvuV.pdb.gz	Structure of the NuA4 acetyltransferase complex bound to the nucleosome.
15	AFDB:G5EGE9	0.226	0.045	6.960E-1	1263	0.127	0.017	G5EGE9.pdb.gz	DPY26_CAEEL Condensin complex subunit dpy-26 OS=Caenorhabditis elegans OX=6239 GN=dpy-26 PE=1 SV=1
16	PDB:5n9jZ	0.250	0.314	8.200E-1	119	0.102	0.143	5n9jZ.pdb.gz
17	PDB:6cnnA	0.224	0.119	1.056	360	0.090	0.042	6cnnA.pdb.gz	Activation mechanism of a human SK-calmodulin channel complex elucidated by cryo-EM structures.
18	PDB:6so5C	0.243	0.273	1.056	144	0.060	0.069	6so5C.pdb.gz	Structural Basis of Tail-Anchored Membrane Protein Biogenesis by the GET Insertase Complex.
19	PDB:5gjqV	0.193	0.135	1.361	257	0.084	0.054	5gjqV.pdb.gz	An atomic structure of the human 26S proteasome.
20	PDB:4gwpA	0.257	0.350	1.450	112	0.108	0.161	4gwpA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	C0H5F4	0.099	35.0	3254	0.127	0.006	RH2B_PLAF7 Reticulocyte-binding protein homolog 2b OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2b PE=1 SV=2
2	Q8IDX6	0.12	35.0	3130	0.127	0.007	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1
3	F4JN05	1.5	31.6	1706	0.102	0.010	BIG4_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 4 OS=Arabidopsis thaliana OX=3702 GN=BIG4 PE=3 SV=1
4	Q63HR2	1.6	31.6	1409	0.096	0.011	TENS2_HUMAN Tensin-2 OS=Homo sapiens OX=9606 GN=TNS2 PE=1 SV=2
5	Q00799	3.8	30.4	2867	0.096	0.006	RBP2_PLAVB Reticulocyte-binding protein 2 OS=Plasmodium vivax (strain Belem) OX=31273 GN=RBP-2 PE=3 SV=2
6	P38704	6.0	29.6	541	0.084	0.026	STP2_YEAST Transcription factor STP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=STP2 PE=1 SV=1
7	P19939	7.2	28.1	88	0.139	0.261	APOC1_RAT Apolipoprotein C-I OS=Rattus norvegicus OX=10116 GN=Apoc1 PE=3 SV=1
8	Q59UQ6	7.6	29.3	607	0.102	0.028	Q59UQ6_CANAL Formin-binding protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=HOF1 PE=4 SV=1
9	Q9SHJ3	7.7	29.3	1958	0.090	0.008	CALS7_ARATH Callose synthase 7 OS=Arabidopsis thaliana OX=3702 GN=CALS7 PE=3 SV=3
10	A0A0B4K7J2	7.9	29.3	2718	0.120	0.007	RBP2_DROME E3 SUMO-protein ligase RanBP2 OS=Drosophila melanogaster OX=7227 GN=Nup358 PE=1 SV=1
11	P0A6V8	7.9	29.3	321	0.114	0.059	GLK_ECOLI Glucokinase OS=Escherichia coli (strain K12) OX=83333 GN=glk PE=1 SV=1
12	A0A2R8Y590	9.2	29.3	2122	0.108	0.008	A0A2R8Y590_HUMAN A-kinase anchoring protein 9 OS=Homo sapiens OX=9606 GN=AKAP9 PE=1 SV=2
13	E9PR05	9.3	29.3	1439	0.127	0.015	E9PR05_HUMAN Lysine methyltransferase 2A (Fragment) OS=Homo sapiens OX=9606 GN=KMT2A PE=1 SV=2
14	Q5EAI9	9.4	28.9	494	0.084	0.028	Q5EAI9_ARATH RING-type E3 ubiquitin transferase OS=Arabidopsis thaliana OX=3702 GN=TEAR1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9402.XP_006921488.1

Rank	PPI partner	STRING score	Description
1	9402.XP_006920136.1	0.978	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial
2	9402.XP_006917207.1	0.977	Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
3	9402.XP_006911074.1	0.975	Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain.
4	9402.XP_006908184.1	0.973	NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial
5	9402.XP_006912612.1	0.967	Carrier of the growing fatty acid chain in fatty acid biosynthesis
6	9402.XP_006923093.1	0.967	Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
7	9402.XP_006912514.1	0.960	NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial
8	9402.XP_006917423.1	0.948	Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed to be not involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
9	9402.XP_006924271.1	0.941	NADH:ubiquinone oxidoreductase subunit S5
10	9402.XP_006923900.1	0.938	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial
11	9402.XP_006921444.1	0.909	NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial
12	9402.XP_006914668.1	0.902	Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
13	9402.XP_006904110.1	0.896	NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial
14	9402.XP_006904194.1	0.891	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11
15	9402.XP_006917124.1	0.868	NADH:ubiquinone oxidoreductase subunit A8
16	9402.XP_006911070.1	0.860	NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial
17	9402.XP_006910622.1	0.854	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5-like
18	9402.XP_006910921.1	0.854	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial
19	9402.XP_006917278.1	0.854	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 isoform X1
20	9402.XP_006905596.1	0.846	Translocase of inner mitochondrial membrane domain-containing protein 1 isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.583	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.999	cellular anatomical entity
GO:0043226	0.890	organelle
GO:0005622	0.872	intracellular anatomical structure
GO:0043227	0.842	membrane-bounded organelle
GO:0043229	0.841	intracellular organelle
GO:0043231	0.833	intracellular membrane-bounded organelle
GO:0016020	0.736	membrane
GO:0005737	0.523	cytoplasm
GO:0098588	0.374	bounding membrane of organelle
GO:0097708	0.365	intracellular vesicle
GO:0005576	0.332	extracellular region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]