StarFunc result for job id A0A1B0GUL7

User Input

>input (405 residues)
MLARRKPMLPALTINPTIAEGPSPTSEGASEANLVDLQKKLEELELDEQQKRLEAFLTQK
AKVGELKDDDFERTSELDAGNGGVVTKVQHRPSGLIMARKLIHLEIKPAIRNQIIREHQV
LHECNSPYIVGFYGAFYCDREISICMEHMDGGSLDQGLKEAKRIPEDILGKVSIAVLRGL
AYLREKHQIMHRNVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMAPERLQG
THYSVQSVIWSMDLSLVELAIERYPIPPPDAKELEAIFGQPVVDREEGEPHSISSWPGSP
GRPNSGYGMDSLPAMAIFELLDYIVKEPPPKLPNGVFTPDFQEFVNKCLIKNPTERADLK
MLTNHAFIKRSEACLLSNHQAKHTLMNTSNSASKWTLTTLMLTTN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q63932	0.797	0.805	5.092E-56	401	0.825	0.833	Q63932.pdb.gz	MP2K2_MOUSE Dual specificity mitogen-activated protein kinase kinase 2 OS=Mus musculus OX=10090 GN=Map2k2 PE=1 SV=2
2	AFDB:A4QPA9	0.770	0.793	3.588E-52	393	0.706	0.728	A4QPA9.pdb.gz	A4QPA9_HUMAN Mitogen-activated protein kinase kinase 1 OS=Homo sapiens OX=9606 GN=MAP2K1 PE=2 SV=1
3	AFDB:Q24324	0.734	0.750	7.872E-44	396	0.538	0.551	Q24324.pdb.gz	DSOR1_DROME Dual specificity mitogen-activated protein kinase kinase dSOR1 OS=Drosophila melanogaster OX=7227 GN=Dsor1 PE=1 SV=2
4	PDB:3eqdA	0.703	0.900	4.386E-43	315	0.622	0.800	3eqdA.pdb.gz	Crystal Structures of MEK1 Binary and Ternary Complexes with Nucleotides and Inhibitors.
5	AFDB:Q10664	0.729	0.762	4.632E-39	387	0.484	0.506	Q10664.pdb.gz	MEK2_CAEEL Dual specificity mitogen-activated protein kinase kinase mek-2 OS=Caenorhabditis elegans OX=6239 GN=mek-2 PE=1 SV=1
6	PDB:5eymA	0.666	0.921	7.537E-36	292	0.573	0.795	5eymA.pdb.gz	Pharmacological Profile of BI 847325, an Orally Bioavailable, ATP-Competitive Inhibitor of MEK and Aurora Kinases.
7	AFDB:G4NEB8	0.643	0.627	1.191E-30	415	0.353	0.345	G4NEB8.pdb.gz	MST7_MAGO7 Mitogen-activated protein kinase kinae MST7 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=MST7 PE=1 SV=1
8	AFDB:A9JRD0	0.619	0.559	7.236E-30	450	0.309	0.278	A9JRD0.pdb.gz	A9JRD0_DANRE Dual specificity mitogen-activated protein kinase kinase 5 OS=Danio rerio OX=7955 GN=zgc:172137 PE=2 SV=1
9	AFDB:Q5B7Q8	0.642	0.486	8.046E-30	539	0.360	0.271	Q5B7Q8.pdb.gz	Q5B7Q8_EMENI MAP kinase kinase (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_03422 PE=4 SV=1
10	AFDB:Q13163	0.623	0.564	3.748E-29	448	0.316	0.286	Q13163.pdb.gz	MP2K5_HUMAN Dual specificity mitogen-activated protein kinase kinase 5 OS=Homo sapiens OX=9606 GN=MAP2K5 PE=1 SV=2
11	AFDB:P10506	0.624	0.740	2.968E-28	340	0.356	0.424	P10506.pdb.gz	BYR1_SCHPO Protein kinase byr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=byr1 PE=1 SV=1
12	AFDB:Q55CL6	0.633	0.393	4.080E-28	660	0.326	0.200	Q55CL6.pdb.gz	MP2K1_DICDI Dual specificity mitogen-activated protein kinase kinase 1 OS=Dictyostelium discoideum OX=44689 GN=mekA PE=1 SV=1
13	PDB:8a8mB	0.550	0.734	1.441E-18	298	0.262	0.356	8a8mB.pdb.gz	Architecture of the MKK6-p38 alpha complex defines the basis of MAPK specificity and activation.
14	PDB:6s73A	0.558	0.821	1.859E-15	269	0.193	0.290	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
15	PDB:4eomC	0.501	0.716	5.372E-15	276	0.163	0.239	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
16	PDB:1blxA	0.472	0.609	7.004E-15	305	0.188	0.249	1blxA.pdb.gz	Crystal structure of the complex of the cyclin D-dependent kinase Cdk6 bound to the cell-cycle inhibitor p19INK4d.
17	PDB:5ufuA	0.536	0.584	4.034E-14	369	0.173	0.190	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
18	PDB:7myjC	0.531	0.467	4.254E-14	465	0.165	0.144	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
19	PDB:4krcA	0.501	0.674	4.988E-14	297	0.188	0.256	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
20	PDB:4c0tA	0.527	0.713	7.231E-14	291	0.131	0.182	4c0tA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A4QPA9	0.0	554	393	0.706	0.728	A4QPA9_HUMAN Mitogen-activated protein kinase kinase 1 OS=Homo sapiens OX=9606 GN=MAP2K1 PE=2 SV=1
2	P29678	0.0	552	393	0.704	0.725	MP2K1_RABIT Dual specificity mitogen-activated protein kinase kinase 1 OS=Oryctolagus cuniculus OX=9986 GN=MAP2K1 PE=1 SV=2
3	P31938	0.0	554	393	0.706	0.728	MP2K1_MOUSE Dual specificity mitogen-activated protein kinase kinase 1 OS=Mus musculus OX=10090 GN=Map2k1 PE=1 SV=2
4	P36506	0.0	670	400	0.830	0.840	MP2K2_RAT Dual specificity mitogen-activated protein kinase kinase 2 OS=Rattus norvegicus OX=10116 GN=Map2k2 PE=1 SV=1
5	P36507	0.0	689	400	0.857	0.868	MP2K2_HUMAN Dual specificity mitogen-activated protein kinase kinase 2 OS=Homo sapiens OX=9606 GN=MAP2K2 PE=1 SV=1
6	Q01986	0.0	555	393	0.706	0.728	MP2K1_RAT Dual specificity mitogen-activated protein kinase kinase 1 OS=Rattus norvegicus OX=10116 GN=Map2k1 PE=1 SV=2
7	Q02750	0.0	554	393	0.706	0.728	MP2K1_HUMAN Dual specificity mitogen-activated protein kinase kinase 1 OS=Homo sapiens OX=9606 GN=MAP2K1 PE=1 SV=2
8	Q63932	0.0	665	401	0.830	0.838	MP2K2_MOUSE Dual specificity mitogen-activated protein kinase kinase 2 OS=Mus musculus OX=10090 GN=Map2k2 PE=1 SV=2
9	I3L5D4	1.51e-173	488	302	0.602	0.808	I3L5D4_PIG Mitogen-activated protein kinase kinase 2 OS=Sus scrofa OX=9823 GN=MAP2K2 PE=1 SV=3
10	Q24324	6.11e-149	429	396	0.526	0.538	DSOR1_DROME Dual specificity mitogen-activated protein kinase kinase dSOR1 OS=Drosophila melanogaster OX=7227 GN=Dsor1 PE=1 SV=2
11	Q10664	1.39e-124	367	387	0.491	0.514	MEK2_CAEEL Dual specificity mitogen-activated protein kinase kinase mek-2 OS=Caenorhabditis elegans OX=6239 GN=mek-2 PE=1 SV=1
12	Q5B7Q8	1.89e-82	264	539	0.370	0.278	Q5B7Q8_EMENI MAP kinase kinase (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_03422 PE=4 SV=1
13	G4NEB8	9.91e-81	256	415	0.336	0.328	MST7_MAGO7 Mitogen-activated protein kinase kinae MST7 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=MST7 PE=1 SV=1
14	P10506	1.28e-78	248	340	0.360	0.429	BYR1_SCHPO Protein kinase byr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=byr1 PE=1 SV=1
15	Q13163	8.46e-75	241	448	0.311	0.281	MP2K5_HUMAN Dual specificity mitogen-activated protein kinase kinase 5 OS=Homo sapiens OX=9606 GN=MAP2K5 PE=1 SV=2
16	Q62862	3.22e-74	240	448	0.311	0.281	MP2K5_RAT Dual specificity mitogen-activated protein kinase kinase 5 OS=Rattus norvegicus OX=10116 GN=Map2k5 PE=1 SV=1
17	Q9WVS7	4.11e-74	239	448	0.311	0.281	MP2K5_MOUSE Dual specificity mitogen-activated protein kinase kinase 5 OS=Mus musculus OX=10090 GN=Map2k5 PE=1 SV=1
18	B1NA67	2.18e-71	233	449	0.306	0.276	B1NA67_DANRE Dual specificity mitogen-activated protein kinase kinase 5 isoform X1 OS=Danio rerio OX=7955 GN=wu:fb73f02 PE=2 SV=1
19	A9JRD0	4.62e-71	232	450	0.299	0.269	A9JRD0_DANRE Dual specificity mitogen-activated protein kinase kinase 5 OS=Danio rerio OX=7955 GN=zgc:172137 PE=2 SV=1
20	P08018	1.28e-68	231	668	0.316	0.192	PBS2_YEAST MAP kinase kinase PBS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PBS2 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	0.032	24.9	ABC1 atypical kinase-like domain
2	PF12330 Haspin_kinase	1.1e+02	13.2	Haspin like kinase domain
3	PF00069 Pkinase	9.1e-49	177.8	Protein kinase domain
4	PF17667 Pkinase_fungal	3.6	17.9	Fungal protein kinase
5	PF07714 PK_Tyr_Ser-Thr	4.8e-24	96.6	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000017394

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000000804	0.953	Kinase suppressor of ras 1
2	9593.ENSGGOP00000011327	0.949	Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. MAP kinase subfamily
3	9593.ENSGGOP00000025331	0.945	B-Raf proto-oncogene, serine/threonine kinase
4	9593.ENSGGOP00000008503	0.944	A-Raf proto-oncogene, serine/threonine kinase
5	9593.ENSGGOP00000019831	0.924	Raf-1 proto-oncogene, serine/threonine kinase
6	9593.ENSGGOP00000008752	0.898	Mitogen-activated protein kinase 3
7	9593.ENSGGOP00000018474	0.879	Kinase suppressor of ras 2
8	9593.ENSGGOP00000015061	0.848	HRas proto-oncogene, GTPase
9	9593.ENSGGOP00000014248	0.828	Mitogen-activated protein kinase kinase kinase 1, E3 ubiquitin protein ligase
10	9593.ENSGGOP00000001116	0.825	Late endosomal/lysosomal adaptor, MAPK and MTOR activator 3
11	9593.ENSGGOP00000003101	0.813	P21 protein (Cdc42/Rac)-activated kinase 1
12	9593.ENSGGOP00000004514	0.812	Mitogen-activated protein kinase kinase kinase 2
13	9593.ENSGGOP00000002131	0.811	Uncharacterized protein
14	9593.ENSGGOP00000024283	0.811	Mitogen-activated protein kinase kinase kinase 3
15	9593.ENSGGOP00000003627	0.809	Belongs to the protein kinase superfamily.
16	9593.ENSGGOP00000007864	0.807	KRAS proto-oncogene, GTPase
17	9593.ENSGGOP00000009478	0.807	Arrestin, beta 1
18	9593.ENSGGOP00000023054	0.796	Mitogen-activated protein kinase 11
19	9593.ENSGGOP00000007089	0.780	P21 protein (Cdc42/Rac)-activated kinase 2
20	9593.ENSGGOP00000014411	0.778	P21 protein (Cdc42/Rac)-activated kinase 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004712	0.999	protein serine/threonine/tyrosine kinase activity
GO:0004708	0.993	MAP kinase kinase activity
GO:0004674	0.933	protein serine/threonine kinase activity
GO:0019899	0.315	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.998	biological regulation
GO:0050794	0.993	regulation of cellular process
GO:0009987	0.992	cellular process
GO:0050896	0.991	response to stimulus
GO:0023052	0.952	signaling
GO:0071704	0.949	organic substance metabolic process
GO:0044237	0.940	cellular metabolic process
GO:1901564	0.938	organonitrogen compound metabolic process
GO:0043412	0.938	macromolecule modification
GO:0035556	0.935	intracellular signal transduction
GO:0019538	0.930	protein metabolic process
GO:0006468	0.923	protein phosphorylation
GO:0048518	0.841	positive regulation of biological process
GO:0048522	0.613	positive regulation of cellular process
GO:0048583	0.550	regulation of response to stimulus
GO:0009966	0.498	regulation of signal transduction
GO:0032501	0.482	multicellular organismal process
GO:0032502	0.461	developmental process
GO:0048856	0.454	anatomical structure development
GO:0019222	0.387	regulation of metabolic process
GO:0060255	0.353	regulation of macromolecule metabolic process
GO:0006950	0.312	response to stress
GO:1902531	0.311	regulation of intracellular signal transduction
GO:0048519	0.307	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0012505	0.998	endomembrane system
GO:0005829	0.998	cytosol
GO:0031410	0.986	cytoplasmic vesicle
GO:0005634	0.985	nucleus
GO:0030054	0.971	cell junction
GO:0071944	0.941	cell periphery
GO:0016020	0.931	membrane
GO:0005768	0.783	endosome
GO:0005770	0.749	late endosome
GO:0005886	0.646	plasma membrane
GO:0070161	0.489	anchoring junction
GO:0005925	0.443	focal adhesion
GO:0005739	0.439	mitochondrion
GO:0005794	0.416	Golgi apparatus
GO:0005769	0.309	early endosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.12.1	0.999	dual-specificity kinase.
EC:2.7.12.2	0.993	mitogen-activated protein kinase kinase.

[back to server]