StarFunc result for job id A0A1B0GUT2

User Input

>input (108 residues)
MDSLALGRWRQRRAEDLQVPGDVKRVCRRLEASGHERGCHQVNACALASWGPEDRELPSR
GCLPAPRPESGQGRLSTGISQNGGRSSAQPCPRCIAGESGHFSHTKNH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:H0YPR8	0.114	0.046	8.104	473	0.259	0.059	H0YPR8.pdb.gz	H0YPR8_TAEGU Dopamine receptor D2 OS=Taeniopygia guttata OX=59729 GN=DRD2 PE=3 SV=2
2	AFDB:H3BQL7	0.126	0.099	8.689	156	0.139	0.096	H3BQL7.pdb.gz	H3BQL7_HUMAN SIN3 transcription regulator family member A OS=Homo sapiens OX=9606 GN=SIN3A PE=1 SV=1
3	AFDB:Q04749	0.127	0.057	9.988	426	0.139	0.035	Q04749.pdb.gz	AVO2_YEAST Target of rapamycin complex 2 subunit AVO2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AVO2 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q2PBN9	0.68	31.2	581	0.167	0.031	Q2PBN9_BOVIN Prolactin receptor (Fragment) OS=Bos taurus OX=9913 GN=prlr PE=3 SV=1
2	Q7VLE8	2.3	29.6	4152	0.167	0.004	Q7VLE8_HAEDU Large supernatant protein 1 OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) OX=233412 GN=lspA1 PE=1 SV=1
3	F4HWS5	5.1	28.5	639	0.185	0.031	F4HWS5_ARATH YTH domain-containing family protein OS=Arabidopsis thaliana OX=3702 GN=ECT7 PE=1 SV=1
4	B9K712	8.1	27.7	186	0.102	0.059	IYD_THENN Iodotyrosine deiodinase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E) OX=309803 GN=IYD PE=1 SV=1
5	P97840	8.1	27.7	354	0.111	0.034	LEG9_RAT Galectin-9 OS=Rattus norvegicus OX=10116 GN=Lgals9 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 118797.XP_007447908.1

Rank	PPI partner	STRING score	Description
1	118797.XP_007446720.1	0.566	Stomatin like 1
2	118797.XP_007456390.1	0.512	Sodium channel subunit beta-4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.615	biological regulation
GO:0050789	0.430	regulation of biological process
GO:0032502	0.348	developmental process
GO:0051171	0.342	regulation of nitrogen compound metabolic process
GO:0031324	0.342	negative regulation of cellular metabolic process
GO:0009987	0.330	cellular process
GO:0051172	0.301	negative regulation of nitrogen compound metabolic process
GO:0032501	0.300	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.995	nucleus
GO:0031981	0.885	nuclear lumen
GO:0005654	0.833	nucleoplasm
GO:0043228	0.355	non-membrane-bounded organelle
GO:0043232	0.354	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]