StarFunc result for job id A0A1B0GUW6

User Input

>input (1196 residues)
MGERAYHGAQVCSGTNPRKCQDLGDSILLLLGSFILLNVWINVVTLLWKHLKSSLRILFR
HFFPKDKQPSGSHPICICSSVDPKNLCSKVSSRVHPRPGFLLRRVNHLDSWIPDTNDEKV
SACCCVPPKCGHAGVPRESARGLYKAGMMGGGEAPQVTASKAQASLLSRPETSSQFPKMS
KLDTGPCHLPQESKTKTPDCAPAEAPAQAQVHSPTHTPVCTPTHPWTRSTDHTAVHTPAH
SWTHSKARTPEGTHSQAQDTSAQAQAHTSAPTPAQTPAHIQAHTPAPTPAKASAHTKAHT
SAQAQTHSPPHTPEYTHSQAHSPEHTSAHSPAQAPMPVPAHPQAHAPEYTSAHAPAYIPD
HSHLVRSSVPVPTSAPAPPGTLAPATTPVLAPTPAPVPASAPSPAPALVMALTTTPVPDP
VPATTPAPIITPIPSTPPAFSHDLSTGHVVYDARREKQNFFHMSSPQNPEYSRKDLATLF
RPQEGQDLVSSGISEQTKQCSGDSAKLPAGSILGYLELRNMEWKNSDDAKDKFPQTKTSP
YCSFHPCSSEKNTDSQAPFYPKFLAYSRDTACAKTCFHSATTAQSSVCTLPPPFTLSLPL
VPPRSFVPPQPTNHQRPSTLIQTPTVLPTSKSPQSILTSQFPIPSLFATISQPLIQPQCP
ECHESLGLTQDSGLQRTPGPSKDSRVPRNLDLAQNPDLYKNPGLTQDPGLHENPGLAPNQ
GLHEFPGLPQDSYLCQNPSPSQDFGLHKNSGITQDSHPQKNTGLTQEAGILRSPCLTQSP
GLHKKTPFTQTSDLQRSSGFTQDSGIYRNLEPNQETVIYKNQDLSQATDHQKNLGSSKDS
GGHKNTGNVQDPGVCSTAGLTEDSGSQKGPYVPQDSEVNKSSGVIQESFLHKSPGLVQTS
GLPKCSGLTQNSGDYKNPGLIQDCGGHKVKGLTQDSNLPSLTQATKVERRFSLPQDVGVY
RSSEHSQDSNLHKCPGINQDPGPHKDPALVQDSGLPKISGLTQESGPYKSSCLIPDPSLY
KNPSPALGSDFVQLLSLLQTPKSTLSLMKSSVPEKAAQKEDAQRHVLWARVQLNENSCPS
KAQVVSNDLQTFSEVPVLIELQSSSWRAGSQHGAYRPVDTVPSGYQNYRQMSMPTHINWK
SHCPGPGTQAGHVVFDARQRRLAVGKDKCEALSPRRLHQEAPSNSGKPSRSGDIRM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P08120	0.046	0.036	2.078E-4	1779	0.160	0.107	P08120.pdb.gz	CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster OX=7227 GN=Col4a1 PE=1 SV=3
2	AFDB:P17140	0.046	0.035	3.474E-4	1758	0.175	0.119	P17140.pdb.gz	CO4A2_CAEEL Collagen alpha-2(IV) chain OS=Caenorhabditis elegans OX=6239 GN=let-2 PE=1 SV=2
3	AFDB:P17139	0.033	0.025	5.808E-4	1759	0.161	0.110	P17139.pdb.gz	CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans OX=6239 GN=emb-9 PE=1 SV=5
4	AFDB:Q5H9F3	0.048	0.038	3.508E-3	1711	0.173	0.121	Q5H9F3.pdb.gz	BCORL_HUMAN BCL-6 corepressor-like protein 1 OS=Homo sapiens OX=9606 GN=BCORL1 PE=1 SV=2
5	AFDB:O94913	0.058	0.046	4.163E-3	1555	0.148	0.114	O94913.pdb.gz	PCF11_HUMAN Pre-mRNA cleavage complex 2 protein Pcf11 OS=Homo sapiens OX=9606 GN=PCF11 PE=1 SV=3
6	AFDB:Q99590	0.043	0.038	3.542E-2	1463	0.144	0.118	Q99590.pdb.gz	SCAFB_HUMAN Protein SCAF11 OS=Homo sapiens OX=9606 GN=SCAF11 PE=1 SV=2
7	AFDB:B0UXF7	0.040	0.036	3.858E-2	1679	0.165	0.117	B0UXF7.pdb.gz
8	AFDB:Q5QNQ9	0.029	0.024	3.858E-2	1845	0.174	0.113	Q5QNQ9.pdb.gz	CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus OX=10090 GN=Col27a1 PE=2 SV=1
9	AFDB:Q8IZC6	0.043	0.031	5.435E-2	1860	0.165	0.106	Q8IZC6.pdb.gz	CORA1_HUMAN Collagen alpha-1(XXVII) chain OS=Homo sapiens OX=9606 GN=COL27A1 PE=1 SV=1
10	AFDB:Q6XZL8	0.041	0.033	5.921E-2	1540	0.133	0.103	Q6XZL8.pdb.gz	Q6XZL8_MOUSE Histone-lysine N-methyltransferase, H3 lysine-79 specific OS=Mus musculus OX=10090 GN=Dot1l PE=1 SV=1
11	PDB:6hu9J	0.028	0.248	4.126	76	0.011	0.171	6hu9J.pdb.gz	Structure of yeast cytochrome c oxidase in a supercomplex with cytochrome bc1.
12	PDB:6o9lQ	0.019	0.044	4.126	430	0.012	0.033	6o9lQ.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.
13	PDB:7wfeBJ	0.022	0.486	4.126	43	0.006	0.163	7wfeBJ.pdb.gz	Supramolecular assembly of chloroplast NADH dehydrogenase-like complex with photosystem I from Arabidopsis thaliana.
14	PDB:4n78F	0.044	0.264	4.495	156	0.010	0.077	4n78F.pdb.gz	The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton.
15	PDB:6msjA	0.018	0.048	5.335	413	0.007	0.019	6msjA.pdb.gz	Cryo-EM structures and dynamics of substrate-engaged human 26S proteasome.
16	PDB:6fvtN	0.025	0.030	5.812	922	0.008	0.010	6fvtN.pdb.gz	Expanded Coverage of the 26S Proteasome Conformational Landscape Reveals Mechanisms of Peptidase Gating.
17	PDB:5yzgX	0.043	0.444	6.331	71	0.003	0.056	5yzgX.pdb.gz	Structure of a human catalytic step I spliceosome
18	PDB:6wucH	0.041	0.218	8.918	179	0.014	0.095	6wucH.pdb.gz
19	PDB:5mdxT	0.019	0.433	9.715	29	0.006	0.241	5mdxT.pdb.gz	Subunit and chlorophyll organization of the plant photosystem II supercomplex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5F289	4.76e-08	58.5	310	0.024	0.094	SPEM1_MOUSE Spermatid maturation protein 1 OS=Mus musculus OX=10090 GN=Spem1 PE=1 SV=1
2	Q4GZE3	0.002	45.1	1215	0.061	0.060	Q4GZE3_TRYB2 Metal-binding domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.750 PE=4 SV=1
3	Q9FN39	0.003	43.5	370	0.018	0.059	ENL01_ARATH Early nodulin-like protein 1 OS=Arabidopsis thaliana OX=3702 GN=ENODL1 PE=2 SV=1
4	Q8I492	0.011	42.4	1434	0.032	0.026	Q8I492_PLAF7 Mature parasite-infected erythrocyte surface antigen OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0500800 PE=4 SV=1
5	P12036	0.045	40.4	1026	0.042	0.049	NFH_HUMAN Neurofilament heavy polypeptide OS=Homo sapiens OX=9606 GN=NEFH PE=1 SV=4
6	Q3IHD2	0.073	39.7	1071	0.048	0.053	Q3IHD2_PSET1 Ribonuclease E OS=Pseudoalteromonas translucida (strain TAC 125) OX=326442 GN=rne PE=1 SV=1
7	Q03386	0.11	39.3	895	0.026	0.035	GNDS_RAT Ral guanine nucleotide dissociation stimulator OS=Rattus norvegicus OX=10116 GN=Ralgds PE=1 SV=1
8	P19246	0.20	38.5	1090	0.045	0.050	NFH_MOUSE Neurofilament heavy polypeptide OS=Mus musculus OX=10090 GN=Nefh PE=1 SV=3
9	D3ZQU7	0.39	37.4	717	0.029	0.049	D3ZQU7_RAT Glycoprotein Ib platelet subunit alpha OS=Rattus norvegicus OX=10116 GN=Gp1ba PE=1 SV=1
10	O35930	1.0	35.8	734	0.039	0.064	GP1BA_MOUSE Platelet glycoprotein Ib alpha chain OS=Mus musculus OX=10090 GN=Gp1ba PE=1 SV=2
11	P16884	1.0	36.2	1072	0.042	0.047	NFH_RAT Neurofilament heavy polypeptide OS=Rattus norvegicus OX=10116 GN=Nefh PE=1 SV=4
12	O75112	1.2	35.8	727	0.027	0.044	LDB3_HUMAN LIM domain-binding protein 3 OS=Homo sapiens OX=9606 GN=LDB3 PE=1 SV=2
13	Q9XIB6	1.4	35.4	847	0.038	0.053	PLRX2_ARATH Pollen-specific leucine-rich repeat extensin-like protein 2 OS=Arabidopsis thaliana OX=3702 GN=PEX2 PE=1 SV=1
14	Q9V3G8	2.0	34.7	373	0.037	0.118	Q9V3G8_DROME RH73259p OS=Drosophila melanogaster OX=7227 GN=Vajk1 PE=2 SV=1
15	Q9JKS4	2.9	34.7	723	0.029	0.048	LDB3_MOUSE LIM domain-binding protein 3 OS=Mus musculus OX=10090 GN=Ldb3 PE=1 SV=1
16	A0A096MKD4	3.5	34.3	707	0.028	0.047	A0A096MKD4_RAT LIM domain binding 3 OS=Rattus norvegicus OX=10116 GN=Ldb3 PE=1 SV=2
17	A0A0G2JYM0	3.6	34.3	729	0.028	0.045	A0A0G2JYM0_RAT LIM domain binding 3 OS=Rattus norvegicus OX=10116 GN=Ldb3 PE=1 SV=1
18	A0A8I5Y5H4	3.9	34.3	709	0.028	0.047	A0A8I5Y5H4_RAT LIM domain binding 3 OS=Rattus norvegicus OX=10116 GN=Ldb3 PE=1 SV=1
19	A0A0G2K2C4	4.0	33.9	679	0.028	0.049	A0A0G2K2C4_RAT LIM domain binding 3 OS=Rattus norvegicus OX=10116 GN=Ldb3 PE=1 SV=1
20	E7EPN9	4.0	34.3	2819	0.023	0.010	E7EPN9_HUMAN Proline rich coiled-coil 2C OS=Homo sapiens OX=9606 GN=PRRC2C PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15670 Spem1	0.01	26.9	Spermatid maturation protein 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9361.ENSDNOP00000020512

Rank	PPI partner	STRING score	Description
1	9361.ENSDNOP00000006716	0.978	MAM domain containing glycosylphosphatidylinositol anchor 1
2	9361.ENSDNOP00000033165	0.977	Neurexin 2
3	9361.ENSDNOP00000000921	0.973	Discs, large homolog 4 (Drosophila)
4	9361.ENSDNOP00000032546	0.953	annotation not available
5	9361.ENSDNOP00000026791	0.914	Neurexin 1
6	9361.ENSDNOP00000026108	0.888	annotation not available
7	9361.ENSDNOP00000034895	0.888	annotation not available
8	9361.ENSDNOP00000002516	0.875	annotation not available
9	9361.ENSDNOP00000031365	0.875	annotation not available
10	9361.ENSDNOP00000020394	0.855	Calcium/calmodulin-dependent protein kinase II beta
11	9361.ENSDNOP00000033301	0.855	Calcium/calmodulin-dependent protein kinase II gamma
12	9361.ENSDNOP00000020807	0.854	Popeye domain containing 2
13	9361.ENSDNOP00000001875	0.823	Usher syndrome 2A (autosomal recessive, mild)
14	9361.ENSDNOP00000024953	0.822	annotation not available
15	9361.ENSDNOP00000007748	0.821	Neuroligin 1
16	9361.ENSDNOP00000013314	0.806	Gephyrin
17	9361.ENSDNOP00000033071	0.805	Discs, large homolog 2 (Drosophila)
18	9361.ENSDNOP00000031929	0.804	annotation not available
19	9361.ENSDNOP00000028751	0.798	Ankyrin repeat and SOCS box containing 12
20	9361.ENSDNOP00000027633	0.792	Calcium/calmodulin-dependent protein kinase II delta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.604	regulation of biological process
GO:0009987	0.410	cellular process
GO:0050794	0.314	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.999	cellular anatomical entity
GO:0043226	0.974	organelle
GO:0005622	0.955	intracellular anatomical structure
GO:0043227	0.928	membrane-bounded organelle
GO:0043229	0.918	intracellular organelle
GO:0043231	0.868	intracellular membrane-bounded organelle
GO:0005737	0.711	cytoplasm
GO:0005634	0.643	nucleus
GO:0016020	0.638	membrane
GO:0005886	0.339	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]