StarFunc result for job id A0A1B0GVS7

User Input

>input (189 residues)
MSETELEKIKVRTAEHLENDKNNISWLKEDTQLTNAKHADEKPINAIVINSVSDFNITDG
PAKENPNEKKLSESSTSLSSLEECQTTFSYLQTDTSVHHRDTDEECASLILACLFCQFWD
CLLMLPGTCETVCTKMCCPSRRYHHTSDENHSRNDCSCNCDMDCSLFESCHETSECLELA
MEISEICYR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9P1T7	0.176	0.145	1.191E-3	246	0.206	0.159	Q9P1T7.pdb.gz	MDFIC_HUMAN MyoD family inhibitor domain-containing protein OS=Homo sapiens OX=9606 GN=MDFIC PE=1 SV=2
2	AFDB:F4I8V6	0.181	0.071	3.371E-1	624	0.159	0.048	F4I8V6.pdb.gz	F4I8V6_ARATH Protein kinase superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At1g11390 PE=1 SV=1
3	AFDB:Q9C5U1	0.146	0.030	8.824E-1	1036	0.101	0.018	Q9C5U1.pdb.gz	AHK3_ARATH Histidine kinase 3 OS=Arabidopsis thaliana OX=3702 GN=AHK3 PE=1 SV=1
4	AFDB:B4DUA7	0.139	0.122	1.216	221	0.111	0.095	B4DUA7.pdb.gz	B4DUA7_HUMAN Mediator of RNA polymerase II transcription subunit 29 OS=Homo sapiens OX=9606 GN=MED29 PE=1 SV=1
5	AFDB:O13826	0.121	0.096	1.297	254	0.143	0.106	O13826.pdb.gz	RFP1_SCHPO E3 ubiquitin-protein ligase complex slx8-rfp subunit rfp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rfp1 PE=1 SV=1
6	AFDB:B7CED8	0.152	0.035	1.905	1170	0.090	0.015	B7CED8.pdb.gz	B7CED8_CAEEL Calcium-transporting ATPase OS=Caenorhabditis elegans OX=6239 GN=mca-3 PE=1 SV=1
7	AFDB:Q5U154	0.126	0.038	1.905	855	0.095	0.021	Q5U154.pdb.gz	Q5U154_DROME RE01051p OS=Drosophila melanogaster OX=7227 GN=Sln PE=2 SV=1
8	AFDB:Q38DZ0	0.109	0.094	2.463	225	0.127	0.107	Q38DZ0.pdb.gz	Q38DZ0_TRYB2 Transmembrane protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.1650 PE=4 SV=1
9	AFDB:Q9ZPQ7	0.131	0.131	2.463	189	0.085	0.085	Q9ZPQ7.pdb.gz	Q9ZPQ7_ARATH At2g03740 OS=Arabidopsis thaliana OX=3702 GN=LEA11 PE=1 SV=1
10	AFDB:C8KI33	0.138	0.065	2.626	646	0.143	0.042	C8KI33.pdb.gz	SUV2_ARATH Protein SENSITIVE TO UV 2 OS=Arabidopsis thaliana OX=3702 GN=SUV2 PE=1 SV=1
11	PDB:7p46A	0.139	0.094	2.752	281	0.063	0.043	7p46A.pdb.gz	Binding of l-kynurenine to X. campestris tryptophan 2,3-dioxygenase.
12	PDB:6uxwA	0.185	0.053	4.903	778	0.116	0.028	6uxwA.pdb.gz	Cryo-EM structure of SWI/SNF complex bound to a nucleosome.
13	PDB:7zjwB	0.095	0.091	5.943	204	0.042	0.039	7zjwB.pdb.gz	Structure of the mammalian ribosome as it decodes the selenocysteine UGA codon.
14	PDB:3craA	0.129	0.109	7.682	239	0.090	0.071	3craA.pdb.gz
15	PDB:7ocaG	0.172	0.205	8.733	158	0.069	0.082	7ocaG.pdb.gz	Gating and modulation of a hetero-octameric AMPA glutamate receptor.
16	PDB:7pubCI	0.110	0.066	8.733	427	0.106	0.047	7pubCI.pdb.gz	Mitoribosomal small subunit maturation involves formation of initiation-like complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8BX65	3.51e-09	56.6	247	0.169	0.130	MDFIC_MOUSE MyoD family inhibitor domain-containing protein OS=Mus musculus OX=10090 GN=Mdfic PE=1 SV=1
2	Q9P1T7	1.05e-08	55.5	246	0.164	0.126	MDFIC_HUMAN MyoD family inhibitor domain-containing protein OS=Homo sapiens OX=9606 GN=MDFIC PE=1 SV=2
3	Q98SK0	3.25e-08	53.9	246	0.254	0.195	MDFIC_XENLA MyoD family inhibitor domain-containing protein OS=Xenopus laevis OX=8355 GN=mdfic PE=2 SV=1
4	Q99750	2.89e-04	42.4	246	0.143	0.110	MDFI_HUMAN MyoD family inhibitor OS=Homo sapiens OX=9606 GN=MDFI PE=1 SV=1
5	Q9AIS0	3.1	30.8	1395	0.122	0.016	Q9AIS0_9STAP Bifunctional autolysin OS=Staphylococcus caprae OX=29380 GN=atlC PE=3 SV=1
6	B4Y0U0	5.5	30.0	472	0.159	0.064	B4Y0U0_MEDTR Isoflavonoid malonyl transferase 1 OS=Medicago truncatula OX=3880 GN=MAT1 PE=2 SV=1
7	M9PHP7	6.3	30.0	1427	0.111	0.015	M9PHP7_DROME Faulty attraction, isoform F OS=Drosophila melanogaster OX=7227 GN=frac PE=4 SV=1
8	E7F221	9.8	29.3	471	0.074	0.030	FRMD8_DANRE FERM domain-containing protein 8 OS=Danio rerio OX=7955 GN=frmd8 PE=2 SV=1
9	Q9VS89	9.8	29.3	1618	0.111	0.013	Q9VS89_DROME FI18763p1 OS=Drosophila melanogaster OX=7227 GN=frac PE=2 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15316 MDFI	5.9e-41	151.8	MyoD family inhibitor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 246437.XP_006160410.1

Rank	PPI partner	STRING score	Description
1	246437.XP_006149620.1	0.658	Homeobox protein aristaless-like 3
2	246437.XP_006158958.1	0.645	Belongs to the G-protein coupled receptor 1 family.
3	246437.XP_006141504.1	0.591	Gamma-aminobutyric acid receptor subunit beta-1
4	246437.XP_006141523.1	0.591	Gamma-aminobutyric acid receptor subunit beta-1
5	246437.XP_006140594.1	0.575	Leukemia-associated protein 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008134	0.723	transcription factor binding
GO:0140297	0.680	DNA-binding transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0048519	0.986	negative regulation of biological process
GO:0023051	0.949	regulation of signaling
GO:0010646	0.945	regulation of cell communication
GO:0048523	0.943	negative regulation of cellular process
GO:0032501	0.942	multicellular organismal process
GO:0032502	0.808	developmental process
GO:0048856	0.798	anatomical structure development
GO:0048583	0.783	regulation of response to stimulus
GO:0023057	0.736	negative regulation of signaling
GO:0010648	0.736	negative regulation of cell communication
GO:0007275	0.666	multicellular organism development
GO:0009966	0.526	regulation of signal transduction
GO:0019222	0.512	regulation of metabolic process
GO:0009968	0.509	negative regulation of signal transduction
GO:0009987	0.420	cellular process
GO:0060255	0.410	regulation of macromolecule metabolic process
GO:0051171	0.393	regulation of nitrogen compound metabolic process
GO:0031323	0.370	regulation of cellular metabolic process
GO:0048513	0.349	animal organ development
GO:0048731	0.348	system development
GO:0065009	0.340	regulation of molecular function
GO:0080090	0.320	regulation of primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	0.999	nucleus
GO:0005886	0.997	plasma membrane
GO:0012505	0.929	endomembrane system
GO:0031974	0.890	membrane-enclosed lumen
GO:0070013	0.883	intracellular organelle lumen
GO:0031981	0.874	nuclear lumen
GO:0043228	0.569	non-membrane-bounded organelle
GO:0043232	0.561	intracellular non-membrane-bounded organelle
GO:0005730	0.430	nucleolus
GO:0005654	0.382	nucleoplasm
GO:0005794	0.380	Golgi apparatus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]