StarFunc result for job id A0A1B0GW35

User Input

>input (172 residues)
MSSLVKEDLEKKLFKPLSQNLYEFIEIEFSVQDRYYLCVSVTKKEEVKIVMVKHYRIGLD
EKYEVTKKWSLNDLQMIDGKEADTDNPFFDLHFKKVYSLEAYSCASKYAFARTVNKLNHA
YLKKDLQIVNFDSTYINDDSIWSSNNKDCLVLMRICFYAFNLVCLSLCPLPL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8R3S6	0.701	0.146	7.679E-13	894	0.279	0.054	Q8R3S6.pdb.gz	EXOC1_MOUSE Exocyst complex component 1 OS=Mus musculus OX=10090 GN=Exoc1 PE=1 SV=4
2	AFDB:Q8NFX7	0.739	0.613	3.191E-11	210	0.233	0.190	Q8NFX7.pdb.gz	STXB6_HUMAN Syntaxin-binding protein 6 OS=Homo sapiens OX=9606 GN=STXBP6 PE=1 SV=2
3	AFDB:Q9VVG4	0.645	0.143	7.214E-9	889	0.151	0.029	Q9VVG4.pdb.gz	EXOC1_DROME Exocyst complex component 1 OS=Drosophila melanogaster OX=7227 GN=Sec3 PE=1 SV=2
4	AFDB:Q20678	0.699	0.151	4.153E-8	848	0.174	0.035	Q20678.pdb.gz	EXOC1_CAEEL Exocyst complex component 1 OS=Caenorhabditis elegans OX=6239 GN=sec-3 PE=1 SV=2
5	AFDB:A0A1D8PMI1	0.628	0.151	1.025E-7	790	0.140	0.030	A0A1D8PMI1.pdb.gz	A0A1D8PMI1_CANAL GTP-Rho binding exocyst subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SEC3 PE=3 SV=1
6	AFDB:P33332	0.645	0.093	3.356E-7	1336	0.140	0.018	P33332.pdb.gz	SEC3_YEAST Exocyst complex component SEC3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC3 PE=1 SV=1
7	AFDB:Q10324	0.523	0.164	7.080E-6	608	0.134	0.038	Q10324.pdb.gz	YD6C_SCHPO Uncharacterized protein C17G8.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.12 PE=4 SV=1
8	AFDB:Q8IQ97	0.488	0.075	2.595E-5	1311	0.128	0.017	Q8IQ97.pdb.gz	Q8IQ97_DROME Pebble, isoform B OS=Drosophila melanogaster OX=7227 GN=pbl PE=4 SV=1
9	AFDB:F4HTA1	0.626	0.142	4.313E-5	888	0.145	0.028	F4HTA1.pdb.gz	F4HTA1_ARATH Exocyst complex component sec3A OS=Arabidopsis thaliana OX=3702 GN=SEC3A PE=1 SV=1
10	AFDB:A8JNN0	0.487	0.107	6.053E-5	900	0.151	0.029	A8JNN0.pdb.gz	A8JNN0_DROME Pebble, isoform E OS=Drosophila melanogaster OX=7227 GN=pbl PE=4 SV=1
11	PDB:5yqrA	0.412	0.285	3.187E-3	268	0.087	0.056	5yqrA.pdb.gz
12	PDB:7mp5A	0.343	0.052	1.308E-2	1629	0.058	0.006	7mp5A.pdb.gz
13	PDB:7pgrN	0.291	0.033	1.835E-2	2423	0.076	0.005	7pgrN.pdb.gz	The structure of neurofibromin isoform 2 reveals different functional states.
14	PDB:7r03B	0.343	0.039	4.793E-2	2246	0.058	0.004	7r03B.pdb.gz
15	PDB:7o4i1	0.352	0.134	5.677E-2	522	0.058	0.019	7o4i1.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
16	PDB:2kr0A	0.327	0.163	6.356E-2	407	0.058	0.025	2kr0A.pdb.gz
17	PDB:2kt4B	0.231	0.245	1.569E-1	157	0.076	0.083	2kt4B.pdb.gz	The v-myc-induced Q83 lipocalin is a siderocalin.
18	PDB:3uzsA	0.349	0.130	1.858E-1	609	0.093	0.026	3uzsA.pdb.gz	Molecular mechanism for inhibition of g protein-coupled receptor kinase 2 by a selective RNA aptamer.
19	PDB:4gh7A	0.200	0.199	2.202E-1	174	0.064	0.063	4gh7A.pdb.gz
20	PDB:5o9zp	0.168	0.331	2.202E-1	73	0.029	0.068	5o9zp.pdb.gz	Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8R3S6	2.51e-15	74.7	894	0.279	0.054	EXOC1_MOUSE Exocyst complex component 1 OS=Mus musculus OX=10090 GN=Exoc1 PE=1 SV=4
2	Q9NV70	3.48e-15	74.3	894	0.273	0.053	EXOC1_HUMAN Exocyst complex component 1 OS=Homo sapiens OX=9606 GN=EXOC1 PE=1 SV=4
3	Q8NFX7	5.20e-04	41.2	210	0.203	0.167	STXB6_HUMAN Syntaxin-binding protein 6 OS=Homo sapiens OX=9606 GN=STXBP6 PE=1 SV=2
4	Q9VVG4	0.28	33.9	889	0.134	0.026	EXOC1_DROME Exocyst complex component 1 OS=Drosophila melanogaster OX=7227 GN=Sec3 PE=1 SV=2
5	Q05502	2.5	30.8	277	0.076	0.047	HHEX_CHICK Hematopoietically-expressed homeobox protein HHEX OS=Gallus gallus OX=9031 GN=HHEX PE=1 SV=1
6	Q9SFW8	6.0	29.6	808	0.110	0.024	NLP5_ARATH Protein NLP5 OS=Arabidopsis thaliana OX=3702 GN=NLP5 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19815 DUF6298	44	14.3	Family of unknown function (DUF6298)
2	PF15277 Sec3-PIP2_bind	7.8e-19	78.9	Exocyst complex component SEC3 N-terminal PIP2 binding PH

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 34839.XP_005393021.1

Rank	PPI partner	STRING score	Description
1	34839.XP_005398993.1	0.966	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 6 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments
2	34839.XP_005377597.1	0.943	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 10 mRNAs, 8 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 13 samples with support for all annotated introns
3	34839.XP_005405033.1	0.918	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments
4	34839.XP_005407503.1	0.918	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 1 Protein, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 6 samples with support for all annotated introns
5	34839.XP_005399261.1	0.911	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 9 mRNAs, 7 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 13 samples with support for all annotated introns
6	34839.XP_005385638.1	0.841	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 3 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 4 samples with support for all annotated introns
7	34839.XP_005385879.1	0.841	Exocyst complex component 6
8	34839.XP_005403744.1	0.780	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 3 samples with support for all annotated introns
9	34839.XP_005407053.1	0.780	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 100% coverage of the annotated genomic feature by RNAseq alignments, including 12 samples with support for all annotated introns
10	34839.XP_005410821.1	0.780	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 13 samples with support for all annotated introns
11	34839.XP_005410823.1	0.780	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 3 samples with support for all annotated introns
12	34839.XP_005412561.1	0.780	Exocyst complex component 3-like protein 2
13	34839.XP_005404917.1	0.632	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 mRNAs, 5 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
14	34839.XP_005388968.1	0.619	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 mRNAs, 7 Proteins, and 95% coverage of the annotated genomic feature by RNAseq alignments, including 3 samples with support for all annotated introns
15	34839.XP_005376030.1	0.616	Hormonally up-regulated neu tumor-associated kinase
16	34839.XP_005391949.1	0.616	Gamma-aminobutyric acid receptor subunit beta-1 isoform X1
17	34839.XP_005387660.1	0.614	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
18	34839.XP_005399413.1	0.612	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
19	34839.XP_005387903.1	0.608	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
20	34839.XP_005379118.1	0.586	Spexin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.944	cellular process
GO:0050789	0.882	regulation of biological process
GO:0050794	0.719	regulation of cellular process
GO:0032502	0.626	developmental process
GO:0048856	0.619	anatomical structure development
GO:0032501	0.539	multicellular organismal process
GO:0007275	0.516	multicellular organism development
GO:0051179	0.338	localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	0.998	intracellular anatomical structure
GO:0071944	0.961	cell periphery
GO:0043229	0.954	intracellular organelle
GO:0005737	0.949	cytoplasm
GO:0016020	0.839	membrane
GO:0005634	0.619	nucleus
GO:0005886	0.535	plasma membrane
GO:0031981	0.326	nuclear lumen
GO:0005654	0.314	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]