StarFunc result for job id A0A1B0GX95

User Input

>input (115 residues)
MGTRLLCWVVLGFLGTDHTGAGVSQSPRYKVAKRGRDVALRCDSISGHVTLYWYRQTLGQ
GSEVLTYSQSDAQRDKSGRPSGRFSAERPERSVSTLKIQRTEQGDSAVYLCASSL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P04435	0.789	0.789	6.108E-13	115	0.652	0.652	P04435.pdb.gz	TVB79_HUMAN T cell receptor beta variable 7-9 OS=Homo sapiens OX=9606 GN=TRBV7-9 PE=1 SV=2
2	AFDB:P01733	0.782	0.782	1.964E-11	115	0.496	0.496	P01733.pdb.gz	TVBL3_HUMAN T cell receptor beta variable 12-3 OS=Homo sapiens OX=9606 GN=TRBV12-3 PE=1 SV=2
3	AFDB:A0A0B4J1P5	0.752	0.752	1.901E-9	115	0.426	0.426	A0A0B4J1P5.pdb.gz	A0A0B4J1P5_MOUSE T cell receptor beta, variable 26 (Fragment) OS=Mus musculus OX=10090 GN=Trbv26 PE=4 SV=5
4	AFDB:A0A0B4J1H2	0.737	0.749	4.589E-9	113	0.339	0.345	A0A0B4J1H2.pdb.gz	A0A0B4J1H2_MOUSE T cell receptor beta, variable 13-3 (Fragment) OS=Mus musculus OX=10090 GN=Trbv13-3 PE=4 SV=1
5	AFDB:A0A140T8N6	0.737	0.749	7.534E-9	113	0.357	0.363	A0A140T8N6.pdb.gz	A0A140T8N6_MOUSE T cell receptor beta, variable 13-2 (Fragment) OS=Mus musculus OX=10090 GN=Trbv13-2 PE=4 SV=1
6	AFDB:A0A0G2LB96	0.743	0.749	1.819E-8	114	0.296	0.298	A0A0G2LB96.pdb.gz	A0A0G2LB96_MOUSE T cell receptor beta, variable 29 (Fragment) OS=Mus musculus OX=10090 GN=Trbv29 PE=1 SV=3
7	AFDB:P0DSE2	0.715	0.283	2.031E-8	310	0.365	0.135	P0DSE2.pdb.gz	TRBR1_HUMAN M1-specific T cell receptor beta chain OS=Homo sapiens OX=9606 GN=TRB PE=1 SV=1
8	AFDB:A0A0G2JGV5	0.659	0.670	1.559E-7	113	0.183	0.186	A0A0G2JGV5.pdb.gz	A0A0G2JGV5_MOUSE T cell receptor gamma, variable 5 (Fragment) OS=Mus musculus OX=10090 GN=Trgv5 PE=4 SV=4
9	AFDB:Q6PIL0	0.680	0.630	2.858E-7	125	0.235	0.216	Q6PIL0.pdb.gz	Q6PIL0_HUMAN IGHV7-81 protein OS=Homo sapiens OX=9606 GN=IGHV7-81 PE=2 SV=1
10	AFDB:P01701	0.699	0.689	4.440E-7	117	0.278	0.274	P01701.pdb.gz	LV151_HUMAN Immunoglobulin lambda variable 1-51 OS=Homo sapiens OX=9606 GN=IGLV1-51 PE=1 SV=2
11	PDB:2h32A	0.660	0.681	1.748E-6	111	0.209	0.216	2h32A.pdb.gz	Structural Insight into Pre-B Cell Receptor Function
12	PDB:5nqkB	0.713	0.354	2.179E-6	242	0.287	0.136	5nqkB.pdb.gz	human 199.16 TCR in complex with Melan-A/MART-1 (26-35) peptide and HLA-A2
13	PDB:3upcA	0.668	0.678	1.138E-5	113	0.183	0.186	3upcA.pdb.gz
14	PDB:6rulA	0.662	0.292	1.868E-5	276	0.209	0.087	6rulA.pdb.gz	Chemogenetic Control of Nanobodies.
15	PDB:4y5xB	0.625	0.646	2.204E-5	111	0.209	0.216	4y5xB.pdb.gz
16	PDB:5hhmI	0.693	0.418	2.460E-5	196	0.226	0.133	5hhmI.pdb.gz	Molecular basis for universal HLA-A*0201-restricted CD8+ T-cell immunity against influenza viruses.
17	PDB:3u7wL	0.629	0.353	3.823E-5	210	0.209	0.114	3u7wL.pdb.gz
18	PDB:6hd8A	0.654	0.178	4.039E-5	461	0.209	0.052	6hd8A.pdb.gz	Structural basis for ion selectivity in TMEM175 K+channels.
19	PDB:4fqqL	0.599	0.340	5.035E-5	213	0.278	0.150	4fqqL.pdb.gz
20	PDB:1ohqA	0.651	0.627	5.320E-5	120	0.200	0.192	1ohqA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P04435	9.93e-53	163	115	0.678	0.678	TVB79_HUMAN T cell receptor beta variable 7-9 OS=Homo sapiens OX=9606 GN=TRBV7-9 PE=1 SV=2
2	P01733	6.07e-38	125	115	0.530	0.530	TVBL3_HUMAN T cell receptor beta variable 12-3 OS=Homo sapiens OX=9606 GN=TRBV12-3 PE=1 SV=2
3	A0A0B4J1P5	7.24e-26	95.1	115	0.417	0.417	A0A0B4J1P5_MOUSE T cell receptor beta, variable 26 (Fragment) OS=Mus musculus OX=10090 GN=Trbv26 PE=4 SV=5
4	A0A075B5J0	2.04e-24	91.7	114	0.417	0.421	A0A075B5J0_MOUSE T cell receptor beta, variable 26 (Fragment) OS=Mus musculus OX=10090 GN=Trbv26 PE=4 SV=7
5	A0A0B4J1H2	3.00e-20	80.9	113	0.400	0.407	A0A0B4J1H2_MOUSE T cell receptor beta, variable 13-3 (Fragment) OS=Mus musculus OX=10090 GN=Trbv13-3 PE=4 SV=1
6	A0A140T8N6	2.24e-19	78.6	113	0.365	0.372	A0A140T8N6_MOUSE T cell receptor beta, variable 13-2 (Fragment) OS=Mus musculus OX=10090 GN=Trbv13-2 PE=4 SV=1
7	A0A0G2LB96	5.83e-18	75.1	114	0.365	0.368	A0A0G2LB96_MOUSE T cell receptor beta, variable 29 (Fragment) OS=Mus musculus OX=10090 GN=Trbv29 PE=1 SV=3
8	A0A075B6N1	8.89e-16	69.3	114	0.313	0.316	TVB19_HUMAN T cell receptor beta variable 19 OS=Homo sapiens OX=9606 GN=TRBV19 PE=1 SV=2
9	P0DSE2	2.23e-14	69.3	310	0.313	0.116	TRBR1_HUMAN M1-specific T cell receptor beta chain OS=Homo sapiens OX=9606 GN=TRB PE=1 SV=1
10	P0DTU4	1.97e-12	63.9	315	0.322	0.117	TRBR2_HUMAN T cell receptor beta chain MC.7.G5 OS=Homo sapiens OX=9606 GN=TRB PE=1 SV=1
11	A0A087WT01	1.25e-09	53.5	109	0.270	0.284	TVA27_HUMAN T cell receptor alpha variable 27 OS=Homo sapiens OX=9606 GN=TRAV27 PE=1 SV=1
12	P0DSE1	1.30e-08	53.1	268	0.270	0.116	TRAR1_HUMAN M1-specific T cell receptor alpha chain OS=Homo sapiens OX=9606 GN=TRA PE=1 SV=1
13	A4JYR2	3.40e-06	45.4	161	0.278	0.199	A4JYR2_DANRE Novel immune-type receptor 14b OS=Danio rerio OX=7955 GN=si:dkey-149k8.5 PE=1 SV=1
14	A0A0G2JEW2	3.77e-06	44.7	117	0.287	0.282	A0A0G2JEW2_MOUSE T cell receptor gamma, variable 3 (Fragment) OS=Mus musculus OX=10090 GN=Trgv3 PE=4 SV=1
15	A0A075B5Z1	4.48e-06	44.3	116	0.313	0.310	A0A075B5Z1_MOUSE T cell receptor gamma, variable 3 OS=Mus musculus OX=10090 GN=Trgv3 PE=4 SV=1
16	A0A0B4J1G7	4.48e-06	44.3	116	0.252	0.250	A0A0B4J1G7_MOUSE T cell receptor beta, variable 1 (Fragment) OS=Mus musculus OX=10090 GN=Trbv1 PE=4 SV=1
17	Q5NV85	8.43e-06	43.1	97	0.235	0.278	Q5NV85_HUMAN V2-8 protein (Fragment) OS=Homo sapiens OX=9606 GN=V2-8 PE=4 SV=1
18	P80748	8.75e-06	43.5	117	0.278	0.274	LV321_HUMAN Immunoglobulin lambda variable 3-21 OS=Homo sapiens OX=9606 GN=IGLV3-21 PE=1 SV=2
19	Q8N355	7.07e-05	42.4	234	0.322	0.158	Q8N355_HUMAN IGL@ protein OS=Homo sapiens OX=9606 GN=IGL@ PE=1 SV=1
20	A0A0B4J1H6	2.02e-04	40.0	120	0.243	0.233	A0A0B4J1H6_MOUSE Immunoglobulin kappa chain variable 2-137 (Fragment) OS=Mus musculus OX=10090 GN=Igkv2-137 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07679 I-set	8.1	17.9	Immunoglobulin I-set domain
2	PF13895 Ig_2	4e+02	12.7	Immunoglobulin domain
3	PF13927 Ig_3	0.52	22.2	Immunoglobulin domain
4	PF07686 V-set	4.8e-11	54.2	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000060790

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000023178	0.884	Mediates the production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3). Plays an important role in the regulation of intracellular signaling cascades.
2	9598.ENSPTRP00000014330	0.870	Phospholipase C, gamma 2 (phosphatidylinositol-specific)
3	9598.ENSPTRP00000044167	0.851	Uncharacterized protein
4	9598.ENSPTRP00000021008	0.846	Zeta-chain (TCR) associated protein kinase 70kDa
5	9598.ENSPTRP00000056922	0.845	Linker for activation of T cells
6	9598.ENSPTRP00000007443	0.839	CD3g molecule, gamma (CD3-TCR complex)
7	9598.ENSPTRP00000007441	0.836	Uncharacterized protein
8	9598.ENSPTRP00000030551	0.824	Uncharacterized protein
9	9598.ENSPTRP00000054564	0.824	Belongs to the MHC class I family.
10	9598.ENSPTRP00000054601	0.824	Patr class I histocompatibility antigen, alpha chain E
11	9598.ENSPTRP00000056399	0.824	Involved in the presentation of foreign antigens to the immune system
12	9598.ENSPTRP00000061016	0.824	Patr class I histocompatibility antigen, A-5 alpha chain
13	9598.ENSPTRP00000016161	0.800	Mitogen-activated protein kinase kinase kinase 3
14	9598.ENSPTRP00000030766	0.667	Pan troglodytes major histocompatibility complex, class II, DR alpha (PATR-DRA), mRNA
15	9598.ENSPTRP00000030734	0.666	Major histocompatibility complex, class II, DR beta 5
16	9598.ENSPTRP00000030768	0.666	Major histocompatibility complex, class II, DQ beta 1
17	9598.ENSPTRP00000054452	0.666	Uncharacterized protein
18	9598.ENSPTRP00000030767	0.657	Major histocompatibility complex, class II, DQ alpha 1
19	9598.ENSPTRP00000030785	0.656	Major histocompatibility complex, class II, DP alpha 1
20	9598.ENSPTRP00000030778	0.654	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003823	0.807	antigen binding
GO:0038023	0.569	signaling receptor activity
GO:0042802	0.417	identical protein binding
GO:0004888	0.349	transmembrane signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.998	response to stimulus
GO:0002376	0.842	immune system process
GO:0009987	0.786	cellular process
GO:0006955	0.664	immune response
GO:0065007	0.643	biological regulation
GO:0050789	0.632	regulation of biological process
GO:0050794	0.604	regulation of cellular process
GO:0009605	0.566	response to external stimulus
GO:0007154	0.558	cell communication
GO:0051716	0.552	cellular response to stimulus
GO:0044419	0.545	biological process involved in interspecies interaction between organisms
GO:0023052	0.486	signaling
GO:0007165	0.464	signal transduction
GO:0009607	0.458	response to biotic stimulus
GO:0043207	0.422	response to external biotic stimulus
GO:0051707	0.409	response to other organism
GO:0007166	0.386	cell surface receptor signaling pathway
GO:0002250	0.336	adaptive immune response

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0005622	0.401	intracellular anatomical structure
GO:0005737	0.393	cytoplasm
GO:0005576	0.378	extracellular region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]