StarFunc result for job id A0A1W2PPF3

User Input

>input (345 residues)
MNLEGTSGGILQKEFWRNRIQYNQSQKDILQSWFQHDPFPDKAAREQLAKEIGVPESNIQ
VWFKNYRVKQRKLDYKCFSEKDQTQGHDQSQHLTQEYLPKEARQKQTFITWTQKNRLVQA
FERNPFPDIATRKKLAEQTGLQESRIQMWFQKQRSLYLKKSRMEPMNLLVDDPNERPDAT
VGWHPINLFLPTDSSHYFSCSHSSSGHETLPPVLPSTQAPWDPFRFHVSQGPNVMIMQPT
QAVQEGEKSDQPLIIPNHLLTLPILTKDLDTPTPFWLQYQEEHQNHKEHSGSGVPQVKSH
SQPEPEHREQQPLNLGQFDISNILQRWDEICQALLAEWDPLKGTH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:C3U3A0	0.179	0.147	1.066E-11	424	0.246	0.200	C3U3A0.pdb.gz	C3U3A0_HUMAN DUX4 OS=Homo sapiens OX=9606 GN=DUX4 PE=2 SV=1
2	AFDB:Q8C0C0	0.185	0.080	7.240E-8	836	0.151	0.062	Q8C0C0.pdb.gz	ZHX2_MOUSE Zinc fingers and homeoboxes protein 2 OS=Mus musculus OX=10090 GN=Zhx2 PE=1 SV=1
3	AFDB:Q06453	0.187	0.160	1.761E-6	408	0.194	0.164	Q06453.pdb.gz	AL_DROME Homeobox protein aristaless OS=Drosophila melanogaster OX=7227 GN=al PE=1 SV=2
4	AFDB:P09081	0.201	0.144	3.505E-6	494	0.157	0.109	P09081.pdb.gz	BCD_DROME Homeotic protein bicoid OS=Drosophila melanogaster OX=7227 GN=bcd PE=1 SV=3
5	AFDB:P06601	0.180	0.102	3.972E-6	613	0.209	0.117	P06601.pdb.gz	PRD_DROME Segmentation protein paired OS=Drosophila melanogaster OX=7227 GN=prd PE=1 SV=1
6	AFDB:P23759	0.185	0.129	3.972E-6	505	0.194	0.133	P23759.pdb.gz	PAX7_HUMAN Paired box protein Pax-7 OS=Homo sapiens OX=9606 GN=PAX7 PE=1 SV=4
7	AFDB:O57419	0.176	0.126	6.976E-6	487	0.186	0.131	O57419.pdb.gz
8	AFDB:P80205	0.188	0.183	1.081E-5	355	0.180	0.175	P80205.pdb.gz	OTX1_MOUSE Homeobox protein OTX1 OS=Mus musculus OX=10090 GN=Otx1 PE=2 SV=1
9	AFDB:Q91994	0.197	0.210	1.574E-5	323	0.171	0.183	Q91994.pdb.gz	OTX1B_DANRE Homeobox protein OTX1 B OS=Danio rerio OX=7955 GN=otx1b PE=2 SV=1
10	AFDB:Q9V490	0.183	0.121	2.021E-5	543	0.197	0.125	Q9V490.pdb.gz	Q9V490_DROME GH14454p OS=Drosophila melanogaster OX=7227 GN=toy PE=2 SV=4
11	PDB:4egcA	0.150	0.096	4.810E-3	539	0.043	0.028	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:2hi3A	0.151	0.589	1.245E-1	73	0.061	0.288	2hi3A.pdb.gz
13	PDB:7fbyA	0.112	0.228	6.337E-1	153	0.029	0.065	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
14	PDB:2cg4A	0.106	0.217	1.113	149	0.032	0.074	2cg4A.pdb.gz	Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
15	PDB:5mymC	0.107	0.151	1.343	205	0.078	0.132	5mymC.pdb.gz	Target Identification of Mycobacterium tuberculosis Phenotypic Hits Using a Concerted Chemogenomic, Biophysical, and Structural Approach.
16	PDB:2cyyA	0.115	0.241	1.522	151	0.029	0.066	2cyyA.pdb.gz	Crystal structure of PH1519 from Pyrococcus horikosii OT3
17	PDB:5nr5A	0.144	0.381	1.522	113	0.041	0.124	5nr5A.pdb.gz
18	PDB:6jcxF	0.093	0.156	1.955	186	0.070	0.129	6jcxF.pdb.gz	Structures and mechanism of transcription initiation by bacterial ECF factors.
19	PDB:5aj0BZ	0.117	0.377	2.081	86	0.017	0.070	5aj0BZ.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
20	PDB:6id0L	0.129	0.097	2.215	475	0.084	0.061	6id0L.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7TNE6	2.20e-41	149	350	0.348	0.343	Q7TNE6_MOUSE Double homeobox B-like OS=Mus musculus OX=10090 GN=Duxbl1 PE=1 SV=1
2	L7MUF5	3.97e-37	134	189	0.200	0.365	L7MUF5_MOUSE Double homeobox B-like 1 (Fragment) OS=Mus musculus OX=10090 GN=Duxbl1 PE=4 SV=1
3	Q3UY88	4.04e-33	124	201	0.188	0.323	Q3UY88_MOUSE Double homeobox B-like 1 OS=Mus musculus OX=10090 GN=Duxbl1 PE=2 SV=1
4	Q6RFH8	1.31e-25	107	374	0.157	0.144	DUX4C_HUMAN Double homeobox protein 4C OS=Homo sapiens OX=9606 GN=DUX4L9 PE=1 SV=1
5	C3U3A0	2.68e-25	107	424	0.157	0.127	C3U3A0_HUMAN DUX4 OS=Homo sapiens OX=9606 GN=DUX4 PE=2 SV=1
6	Q9UBX2	2.68e-25	107	424	0.157	0.127	DUX4_HUMAN Double homeobox protein 4 OS=Homo sapiens OX=9606 GN=DUX4 PE=1 SV=2
7	A6NLW8	2.84e-25	103	204	0.168	0.284	DUXA_HUMAN Double homeobox protein A OS=Homo sapiens OX=9606 GN=DUXA PE=2 SV=1
8	O43812	1.96e-23	97.1	170	0.157	0.318	DUX1_HUMAN Double homeobox protein 1 OS=Homo sapiens OX=9606 GN=DUX1 PE=1 SV=1
9	L7MUF2	8.06e-16	73.6	76	0.096	0.434	L7MUF2_MOUSE Double homeobox B-like 1 (Fragment) OS=Mus musculus OX=10090 GN=Duxbl1 PE=4 SV=1
10	O18381	9.90e-11	65.5	857	0.084	0.034	PAX6_DROME Paired box protein Pax-6 OS=Drosophila melanogaster OX=7227 GN=ey PE=1 SV=3
11	Q9V490	4.36e-10	63.2	543	0.081	0.052	Q9V490_DROME GH14454p OS=Drosophila melanogaster OX=7227 GN=toy PE=2 SV=4
12	Q9XZC2	4.36e-10	63.2	543	0.081	0.052	Q9XZC2_DROME Transcription factor Toy OS=Drosophila melanogaster OX=7227 GN=toy PE=2 SV=1
13	A0A1W2PSB5	1.14e-09	60.1	221	0.078	0.122	A0A1W2PSB5_HUMAN Paired box 6 OS=Homo sapiens OX=9606 GN=PAX6 PE=1 SV=1
14	V5ZE41	1.16e-09	60.8	276	0.081	0.101	V5ZE41_DANRE Paired box 10 OS=Danio rerio OX=7955 GN=pax10 PE=2 SV=1
15	I3IT91	1.21e-09	60.5	275	0.081	0.102	I3IT91_DANRE Paired box 10 OS=Danio rerio OX=7955 GN=pax10 PE=3 SV=1
16	P21711	1.29e-09	61.2	377	0.084	0.077	MIX1_XENLA Homeobox protein Mix.1 OS=Xenopus laevis OX=8355 GN=mix-a PE=2 SV=2
17	A0A1W2PRU4	1.80e-09	60.1	263	0.078	0.103	A0A1W2PRU4_HUMAN Paired box 6 (Fragment) OS=Homo sapiens OX=9606 GN=PAX6 PE=1 SV=1
18	A0A1W2PP27	1.89e-09	59.7	260	0.078	0.104	A0A1W2PP27_HUMAN Paired box 6 (Fragment) OS=Homo sapiens OX=9606 GN=PAX6 PE=1 SV=1
19	A0A1W2PQ31	2.05e-09	60.1	277	0.078	0.097	A0A1W2PQ31_HUMAN Paired box 6 (Fragment) OS=Homo sapiens OX=9606 GN=PAX6 PE=1 SV=1
20	A0A1W2PNS7	2.13e-09	60.1	281	0.078	0.096	A0A1W2PNS7_HUMAN Paired box 6 (Fragment) OS=Homo sapiens OX=9606 GN=PAX6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10208 ARMET_C	9.7e+02	10.6	ARMET, C-terminal
2	PF04218 CENP-B_N	0.81	20.7	CENP-B N-terminal DNA-binding domain
3	PF19955 EAD1	3.3e+02	13.2	Effector-associated domain 1
4	PF05920 Homeobox_KN	1.4e-10	52.2	Homeobox KN domain
5	PF00046 Homeodomain	1.1e-22	90.9	Homeodomain
6	PF01381 HTH_3	33	16.0	Helix-turn-helix
7	PF13411 MerR_1	15	17.1	MerR HTH family regulatory protein
8	PF05269 Phage_CII	7.9	18.1	Bacteriophage CII protein
9	PF15943 YdaS_antitoxin	31	16.0	Putative antitoxin of bacterial toxin-antitoxin system, YdaS/YdaT

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000000016

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000010494	0.593	Cell surface proteoglycan
2	60711.ENSCSAP00000008576	0.538	Cell surface proteoglycan
3	60711.ENSCSAP00000000042	0.533	Adenosine deaminase, tRNA-specific 1
4	60711.ENSCSAP00000007277	0.525	Interleukin 5 receptor, alpha
5	60711.ENSCSAP00000004340	0.522	Cell surface proteoglycan

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0005515	0.993	protein binding
GO:0140110	0.964	transcription regulator activity
GO:0003700	0.871	DNA-binding transcription factor activity
GO:0000976	0.721	transcription cis-regulatory region binding
GO:0000981	0.583	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.538	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.978	regulation of biological process
GO:0050794	0.881	regulation of cellular process
GO:0019222	0.744	regulation of metabolic process
GO:0060255	0.654	regulation of macromolecule metabolic process
GO:0032502	0.594	developmental process
GO:0032501	0.392	multicellular organismal process
GO:0048856	0.357	anatomical structure development
GO:0010468	0.336	regulation of gene expression
GO:0009987	0.318	cellular process
GO:0080090	0.316	regulation of primary metabolic process
GO:0051171	0.316	regulation of nitrogen compound metabolic process
GO:0007275	0.305	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031974	0.677	membrane-enclosed lumen
GO:0070013	0.661	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]