StarFunc result for job id A0A1W2PPH5

User Input

>input (198 residues)
METGRQTGVSAEMLAMPRGLKGSKKDGIPEDLDGNLEEPRDQEGELRSEDVMDLTEGDSE
ASASAPPAAKRRKTHTKRKKERKPTVDAEEAQRMTTLLSAMSEEQLSRYEVCRRSAFPRA
RIAGLMRSITGSSVSENAAIAMAGIAKVFVGEVVEEALDMCEMWGETPPLQPKHLREAVH
RLKPKGLFPNSNYKRVMF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15544	0.545	0.514	8.019E-15	211	0.540	0.507	Q15544.pdb.gz	TAF11_HUMAN Transcription initiation factor TFIID subunit 11 OS=Homo sapiens OX=9606 GN=TAF11 PE=1 SV=1
2	AFDB:Q99JX1	0.607	0.572	1.486E-14	211	0.490	0.460	Q99JX1.pdb.gz	TAF11_MOUSE Transcription initiation factor TFIID subunit 11 OS=Mus musculus OX=10090 GN=Taf11 PE=1 SV=1
3	AFDB:P49906	0.546	0.551	1.515E-12	196	0.389	0.393	P49906.pdb.gz	TAF11_DROME Transcription initiation factor TFIID subunit 11 OS=Drosophila melanogaster OX=7227 GN=Taf11 PE=1 SV=1
4	AFDB:A0A3B3ITY8	0.354	0.351	2.236E-10	200	0.460	0.455	A0A3B3ITY8.pdb.gz	A0A3B3ITY8_HUMAN TATA-box binding protein associated factor 11 OS=Homo sapiens OX=9606 GN=TAF11 PE=1 SV=1
5	AFDB:Q9US54	0.493	0.491	2.691E-10	199	0.293	0.291	Q9US54.pdb.gz	TAF11_SCHPO Transcription initiation factor TFIID subunit 11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=taf11 PE=3 SV=1
6	PDB:7edxk	0.453	0.884	6.902E-10	98	0.348	0.704	7edxk.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
7	AFDB:Q9M565	0.528	0.499	9.618E-9	210	0.298	0.281	Q9M565.pdb.gz	TAF11_ARATH Transcription initiation factor TFIID subunit 11 OS=Arabidopsis thaliana OX=3702 GN=TAF11 PE=1 SV=1
8	PDB:1bfmA	0.324	0.862	9.752E-3	69	0.076	0.217	1bfmA.pdb.gz
9	PDB:2rvqD	0.314	0.461	1.327E-2	129	0.091	0.140	2rvqD.pdb.gz
10	PDB:5z30G	0.297	0.504	1.699E-2	110	0.106	0.191	5z30G.pdb.gz	Cancer-associated mutations of histones H2B, H3.1 and H2A.Z.1 affect the structure and stability of the nucleosome.
11	PDB:4draH	0.305	0.717	1.807E-2	76	0.071	0.184	4draH.pdb.gz
12	PDB:2rvqC	0.321	0.454	2.044E-2	133	0.121	0.180	2rvqC.pdb.gz
13	PDB:5y27A	0.308	0.591	2.044E-2	98	0.091	0.184	5y27A.pdb.gz
14	PDB:7egdF	0.327	0.159	2.616E-2	412	0.045	0.022	7egdF.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
15	PDB:1jfiB	0.326	0.470	2.959E-2	135	0.071	0.104	1jfiB.pdb.gz	Crystal structure of negative cofactor 2 recognizing the TBP-DNA transcription complex.
16	PDB:1b67A	0.320	0.887	3.347E-2	68	0.076	0.221	1b67A.pdb.gz
17	AFDB:Q9W3V9	0.326	0.114	3.959E-2	601	0.162	0.053	Q9W3V9.pdb.gz	Q9W3V9_DROME Nuclear factor Y-box C OS=Drosophila melanogaster OX=7227 GN=Nf-YC PE=1 SV=1
18	AFDB:Q12962	0.295	0.270	5.067E-2	218	0.177	0.161	Q12962.pdb.gz	TAF10_HUMAN Transcription initiation factor TFIID subunit 10 OS=Homo sapiens OX=9606 GN=TAF10 PE=1 SV=1
19	AFDB:Q8IHQ2	0.322	0.055	6.097E-2	1301	0.136	0.021	Q8IHQ2.pdb.gz	Q8IHQ2_PLAF7 Oocyst rupture protein 1, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1146600 PE=3 SV=1
20	AFDB:Q9U226	0.326	0.194	1.062E-1	342	0.116	0.067	Q9U226.pdb.gz	TAF12_CAEEL Transcription initiation factor TFIID subunit 12 OS=Caenorhabditis elegans OX=6239 GN=taf-12 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q15544	1.71e-65	202	211	0.581	0.545	TAF11_HUMAN Transcription initiation factor TFIID subunit 11 OS=Homo sapiens OX=9606 GN=TAF11 PE=1 SV=1
2	Q99JX1	1.06e-63	197	211	0.566	0.531	TAF11_MOUSE Transcription initiation factor TFIID subunit 11 OS=Mus musculus OX=10090 GN=Taf11 PE=1 SV=1
3	A0A3B3ITY8	9.71e-39	134	200	0.439	0.435	A0A3B3ITY8_HUMAN TATA-box binding protein associated factor 11 OS=Homo sapiens OX=9606 GN=TAF11 PE=1 SV=1
4	P49906	3.11e-36	127	196	0.313	0.316	TAF11_DROME Transcription initiation factor TFIID subunit 11 OS=Drosophila melanogaster OX=7227 GN=Taf11 PE=1 SV=1
5	Q9US54	4.34e-23	93.6	199	0.242	0.241	TAF11_SCHPO Transcription initiation factor TFIID subunit 11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=taf11 PE=3 SV=1
6	Q9M565	3.25e-17	78.2	210	0.222	0.210	TAF11_ARATH Transcription initiation factor TFIID subunit 11 OS=Arabidopsis thaliana OX=3702 GN=TAF11 PE=1 SV=1
7	Q04226	4.53e-07	51.2	346	0.081	0.046	TAF11_YEAST Transcription initiation factor TFIID subunit 11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TAF11 PE=1 SV=1
8	Q8TF80	0.21	34.3	269	0.126	0.093	WTF5_SCHPO Meiotic drive suppressor wtf5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=wtf5 PE=3 SV=1
9	O50064	0.51	33.5	654	0.146	0.044	FIMB2_ARATH Fimbrin-2 OS=Arabidopsis thaliana OX=3702 GN=FIM2 PE=2 SV=1
10	P79263	2.2	31.6	921	0.126	0.027	ITIH4_PIG Inter-alpha-trypsin inhibitor heavy chain H4 OS=Sus scrofa OX=9823 GN=ITIH4 PE=1 SV=1
11	U3H0P2	2.7	30.8	249	0.111	0.088	WTF25_SCHPO Meiotic drive suppressor wtf25 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=wtf25 PE=3 SV=1
12	B4E1H0	7.2	29.3	165	0.071	0.085	B4E1H0_HUMAN cDNA FLJ50351, highly similar to Transcription initiation protein SPT3 homolog OS=Homo sapiens OX=9606 PE=2 SV=1
13	Q86XD5	9.2	29.3	332	0.051	0.030	F131B_HUMAN Protein FAM131B OS=Homo sapiens OX=9606 GN=FAM131B PE=1 SV=3
14	O74474	9.9	29.3	329	0.111	0.067	WTF21_SCHPO Meiotic drive suppressor wtf21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=wtf21 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00808 CBFD_NFYB_HMF	0.23	23.1	Histone-like transcription factor (CBF/NF-Y) and archaeal histone
2	PF06070 Herpes_UL32	86	12.3	Herpesvirus large structural phosphoprotein UL32
3	PF00125 Histone	57	15.4	Core histone H2A/H2B/H3/H4
4	PF14695 LINES_C	4.5e+02	11.7	Lines C-terminus
5	PF16906 Ribosomal_L26	1.2e+02	14.5	Ribosomal proteins L26 eukaryotic, L24P archaeal
6	PF04719 TAFII28	2.5e-27	106.1	hTAFII28-like protein conserved region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000020068

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000002710	0.924	TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa
2	9593.ENSGGOP00000007336	0.924	TAF2 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 150kDa
3	9593.ENSGGOP00000000388	0.921	Transcription initiation factor TFIID subunit 10
4	9593.ENSGGOP00000008371	0.914	TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa
5	9593.ENSGGOP00000008899	0.913	TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa
6	9593.ENSGGOP00000005330	0.889	TAF5 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 100kDa
7	9593.ENSGGOP00000027533	0.888	TAF8 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 43kDa
8	9593.ENSGGOP00000016296	0.883	TAF3 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 140kDa
9	9593.ENSGGOP00000002080	0.859	Uncharacterized protein
10	9593.ENSGGOP00000003902	0.859	TAF4b RNA polymerase II, TATA box binding protein (TBP)-associated factor, 105kDa
11	9593.ENSGGOP00000009307	0.855	Uncharacterized protein
12	9593.ENSGGOP00000023578	0.855	Uncharacterized protein
13	9593.ENSGGOP00000001038	0.851	TATA box binding protein like 2
14	9593.ENSGGOP00000002430	0.851	TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa
15	9593.ENSGGOP00000004050	0.851	TATA-box binding protein associated factor 9
16	9593.ENSGGOP00000011550	0.851	TATA box binding protein
17	9593.ENSGGOP00000015303	0.851	Transcription initiation factor TFIID subunit
18	9593.ENSGGOP00000026097	0.851	Transcription initiation factor TFIID subunit
19	9593.ENSGGOP00000018571	0.846	TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa
20	9593.ENSGGOP00000011524	0.836	TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140223	0.958	general transcription initiation factor activity
GO:0016251	0.950	RNA polymerase II general transcription initiation factor activity
GO:0003676	0.909	nucleic acid binding
GO:0008134	0.860	transcription factor binding
GO:0003677	0.839	DNA binding
GO:0061629	0.513	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0016922	0.344	nuclear receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0060255	0.988	regulation of macromolecule metabolic process
GO:0010468	0.975	regulation of gene expression
GO:0009987	0.967	cellular process
GO:0048518	0.967	positive regulation of biological process
GO:0071704	0.905	organic substance metabolic process
GO:0044237	0.904	cellular metabolic process
GO:0044238	0.892	primary metabolic process
GO:0050794	0.879	regulation of cellular process
GO:0006807	0.877	nitrogen compound metabolic process
GO:0046483	0.873	heterocycle metabolic process
GO:1901360	0.869	organic cyclic compound metabolic process
GO:1901576	0.864	organic substance biosynthetic process
GO:0044249	0.864	cellular biosynthetic process
GO:0043170	0.862	macromolecule metabolic process
GO:0034654	0.849	nucleobase-containing compound biosynthetic process
GO:0009059	0.848	macromolecule biosynthetic process
GO:0006351	0.822	DNA-templated transcription
GO:0006366	0.809	transcription by RNA polymerase II
GO:0080090	0.686	regulation of primary metabolic process
GO:0071840	0.685	cellular component organization or biogenesis
GO:0016043	0.677	cellular component organization
GO:0051171	0.677	regulation of nitrogen compound metabolic process
GO:0009893	0.656	positive regulation of metabolic process
GO:0019219	0.640	regulation of nucleobase-containing compound metabolic process
GO:0010604	0.619	positive regulation of macromolecule metabolic process
GO:0051252	0.611	regulation of RNA metabolic process
GO:0006367	0.610	transcription initiation at RNA polymerase II promoter
GO:0048522	0.517	positive regulation of cellular process
GO:0010556	0.508	regulation of macromolecule biosynthetic process
GO:0031326	0.508	regulation of cellular biosynthetic process
GO:0006355	0.504	regulation of DNA-templated transcription
GO:0051173	0.426	positive regulation of nitrogen compound metabolic process
GO:0031325	0.425	positive regulation of cellular metabolic process
GO:1903508	0.416	positive regulation of nucleic acid-templated transcription
GO:0045893	0.411	positive regulation of DNA-templated transcription
GO:0006357	0.354	regulation of transcription by RNA polymerase II
GO:0051123	0.332	RNA polymerase II preinitiation complex assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.998	nucleus
GO:0005654	0.986	nucleoplasm
GO:0005737	0.753	cytoplasm
GO:0032991	0.568	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]