StarFunc result for job id A0A1W2PPL8

User Input

>input (197 residues)
METGRQTGVSAEMFAIPRGLKGCNEDGIPEALDGNLEEPRAQECELRSEDVMDLTVVDNE
ASASAPPAAKRQKTDTKGQKERKPSVDAEEAQRMTTLLSAMSEEQLSRYEVCRQLAFPKA
LVARLMWSITGRSVPENMAIAMAGIAKVFVGEVVEEALDMCEMWGEMPPLQPMDLREAVC
RLKPKGLFPNNYKKVMF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q99JX1	0.562	0.526	5.391E-15	211	0.513	0.479	Q99JX1.pdb.gz	TAF11_MOUSE Transcription initiation factor TFIID subunit 11 OS=Mus musculus OX=10090 GN=Taf11 PE=1 SV=1
2	AFDB:Q15544	0.540	0.507	6.111E-15	211	0.574	0.536	Q15544.pdb.gz	TAF11_HUMAN Transcription initiation factor TFIID subunit 11 OS=Homo sapiens OX=9606 GN=TAF11 PE=1 SV=1
3	AFDB:P49906	0.536	0.539	6.446E-12	196	0.386	0.388	P49906.pdb.gz	TAF11_DROME Transcription initiation factor TFIID subunit 11 OS=Drosophila melanogaster OX=7227 GN=Taf11 PE=1 SV=1
4	AFDB:A0A3B3ITY8	0.324	0.319	8.978E-11	200	0.457	0.450	A0A3B3ITY8.pdb.gz	A0A3B3ITY8_HUMAN TATA-box binding protein associated factor 11 OS=Homo sapiens OX=9606 GN=TAF11 PE=1 SV=1
5	AFDB:Q9US54	0.502	0.497	1.308E-10	199	0.294	0.291	Q9US54.pdb.gz	TAF11_SCHPO Transcription initiation factor TFIID subunit 11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=taf11 PE=3 SV=1
6	PDB:7edxk	0.449	0.863	1.555E-9	98	0.335	0.673	7edxk.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
7	AFDB:Q9M565	0.532	0.501	2.383E-8	210	0.274	0.257	Q9M565.pdb.gz	TAF11_ARATH Transcription initiation factor TFIID subunit 11 OS=Arabidopsis thaliana OX=3702 GN=TAF11 PE=1 SV=1
8	PDB:1bfmA	0.327	0.866	6.457E-3	69	0.071	0.203	1bfmA.pdb.gz
9	PDB:4draH	0.320	0.756	1.761E-2	76	0.076	0.197	4draH.pdb.gz
10	PDB:5y27A	0.331	0.633	2.566E-2	98	0.076	0.153	5y27A.pdb.gz
11	PDB:1b67A	0.320	0.875	3.097E-2	68	0.071	0.206	1b67A.pdb.gz
12	PDB:7egdF	0.328	0.160	3.297E-2	412	0.061	0.029	7egdF.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
13	PDB:5z30G	0.300	0.509	3.980E-2	110	0.102	0.182	5z30G.pdb.gz	Cancer-associated mutations of histones H2B, H3.1 and H2A.Z.1 affect the structure and stability of the nucleosome.
14	PDB:4h9sA	0.297	0.589	4.237E-2	89	0.076	0.169	4h9sA.pdb.gz
15	PDB:2rvqD	0.315	0.464	4.511E-2	129	0.081	0.124	2rvqD.pdb.gz
16	AFDB:Q12962	0.299	0.274	4.663E-2	218	0.168	0.151	Q12962.pdb.gz	TAF10_HUMAN Transcription initiation factor TFIID subunit 10 OS=Homo sapiens OX=9606 GN=TAF10 PE=1 SV=1
17	PDB:5y26B	0.297	0.600	6.573E-2	92	0.056	0.120	5y26B.pdb.gz
18	AFDB:O17072	0.315	0.272	6.794E-2	232	0.152	0.129	O17072.pdb.gz	NFYC1_CAEEL Nuclear transcription factor Y subunit nfyc-1 OS=Caenorhabditis elegans OX=6239 GN=nfyc-1 PE=1 SV=2
19	AFDB:Q9SRS3	0.174	0.154	8.200E-2	232	0.132	0.112	Q9SRS3.pdb.gz	YMG11_ARATH YlmG homolog protein 1-1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=YLMG1-1 PE=2 SV=1
20	AFDB:Q8IHQ2	0.350	0.059	1.054E-1	1301	0.157	0.024	Q8IHQ2.pdb.gz	Q8IHQ2_PLAF7 Oocyst rupture protein 1, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1146600 PE=3 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q15544	8.00e-63	195	211	0.574	0.536	TAF11_HUMAN Transcription initiation factor TFIID subunit 11 OS=Homo sapiens OX=9606 GN=TAF11 PE=1 SV=1
2	Q99JX1	2.42e-57	181	211	0.543	0.507	TAF11_MOUSE Transcription initiation factor TFIID subunit 11 OS=Mus musculus OX=10090 GN=Taf11 PE=1 SV=1
3	A0A3B3ITY8	1.17e-39	136	200	0.437	0.430	A0A3B3ITY8_HUMAN TATA-box binding protein associated factor 11 OS=Homo sapiens OX=9606 GN=TAF11 PE=1 SV=1
4	P49906	2.03e-31	114	196	0.310	0.311	TAF11_DROME Transcription initiation factor TFIID subunit 11 OS=Drosophila melanogaster OX=7227 GN=Taf11 PE=1 SV=1
5	Q9US54	2.38e-18	80.9	199	0.228	0.226	TAF11_SCHPO Transcription initiation factor TFIID subunit 11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=taf11 PE=3 SV=1
6	Q9M565	3.89e-13	67.4	210	0.203	0.190	TAF11_ARATH Transcription initiation factor TFIID subunit 11 OS=Arabidopsis thaliana OX=3702 GN=TAF11 PE=1 SV=1
7	Q04226	5.74e-06	48.1	346	0.107	0.061	TAF11_YEAST Transcription initiation factor TFIID subunit 11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TAF11 PE=1 SV=1
8	B2RXL7	2.6	31.2	1672	0.107	0.013	B2RXL7_MOUSE Kidins220 protein OS=Mus musculus OX=10090 GN=Kidins220 PE=2 SV=1
9	A0A1Y7VME9	4.3	30.8	1763	0.107	0.012	A0A1Y7VME9_MOUSE Kinase D-interacting substrate 220 OS=Mus musculus OX=10090 GN=Kidins220 PE=1 SV=1
10	A0A1Y7VMH7	4.3	30.8	1672	0.107	0.013	A0A1Y7VMH7_MOUSE Kinase D-interacting substrate 220 OS=Mus musculus OX=10090 GN=Kidins220 PE=1 SV=1
11	Q38AQ6	4.4	30.0	234	0.091	0.077	Q38AQ6_TRYB2 Small nuclear RNA activating protein 3 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.3660 PE=4 SV=1
12	Q9BQS8	4.4	30.4	1478	0.203	0.027	FYCO1_HUMAN FYVE and coiled-coil domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FYCO1 PE=1 SV=3
13	E9Q9B7	4.8	30.4	1793	0.107	0.012	E9Q9B7_MOUSE Kinase D-interacting substrate 220 OS=Mus musculus OX=10090 GN=Kidins220 PE=1 SV=1
14	Q80SX9	4.8	30.4	1554	0.107	0.014	Q80SX9_MOUSE Kidins220 protein (Fragment) OS=Mus musculus OX=10090 GN=Kidins220 PE=2 SV=1
15	Q4WCR1	5.6	30.0	537	0.122	0.045	Q4WCR1_ASPFU Glycosyltransferase family 31 protein OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_6G02120 PE=4 SV=1
16	O88509	9.0	29.6	859	0.112	0.026	DNM3B_MOUSE DNA (cytosine-5)-methyltransferase 3B OS=Mus musculus OX=10090 GN=Dnmt3b PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14695 LINES_C	21	16.0	Lines C-terminus
2	PF04719 TAFII28	2.2e-25	99.8	hTAFII28-like protein conserved region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000020068

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000002710	0.924	TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa
2	9593.ENSGGOP00000007336	0.924	TAF2 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 150kDa
3	9593.ENSGGOP00000000388	0.921	Transcription initiation factor TFIID subunit 10
4	9593.ENSGGOP00000008371	0.914	TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa
5	9593.ENSGGOP00000008899	0.913	TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa
6	9593.ENSGGOP00000005330	0.889	TAF5 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 100kDa
7	9593.ENSGGOP00000027533	0.888	TAF8 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 43kDa
8	9593.ENSGGOP00000016296	0.883	TAF3 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 140kDa
9	9593.ENSGGOP00000002080	0.859	Uncharacterized protein
10	9593.ENSGGOP00000003902	0.859	TAF4b RNA polymerase II, TATA box binding protein (TBP)-associated factor, 105kDa
11	9593.ENSGGOP00000009307	0.855	Uncharacterized protein
12	9593.ENSGGOP00000023578	0.855	Uncharacterized protein
13	9593.ENSGGOP00000001038	0.851	TATA box binding protein like 2
14	9593.ENSGGOP00000002430	0.851	TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa
15	9593.ENSGGOP00000004050	0.851	TATA-box binding protein associated factor 9
16	9593.ENSGGOP00000011550	0.851	TATA box binding protein
17	9593.ENSGGOP00000015303	0.851	Transcription initiation factor TFIID subunit
18	9593.ENSGGOP00000026097	0.851	Transcription initiation factor TFIID subunit
19	9593.ENSGGOP00000018571	0.846	TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa
20	9593.ENSGGOP00000011524	0.836	TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0140223	0.925	general transcription initiation factor activity
GO:0016251	0.923	RNA polymerase II general transcription initiation factor activity
GO:0008134	0.854	transcription factor binding
GO:0003676	0.631	nucleic acid binding
GO:0061629	0.526	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0003677	0.488	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0060255	0.987	regulation of macromolecule metabolic process
GO:0010468	0.969	regulation of gene expression
GO:0009987	0.950	cellular process
GO:0048518	0.883	positive regulation of biological process
GO:0044238	0.803	primary metabolic process
GO:0071704	0.788	organic substance metabolic process
GO:0044237	0.773	cellular metabolic process
GO:0006807	0.738	nitrogen compound metabolic process
GO:1901576	0.700	organic substance biosynthetic process
GO:0044249	0.697	cellular biosynthetic process
GO:0043170	0.691	macromolecule metabolic process
GO:0006139	0.681	nucleobase-containing compound metabolic process
GO:0090304	0.661	nucleic acid metabolic process
GO:0034654	0.661	nucleobase-containing compound biosynthetic process
GO:0009059	0.656	macromolecule biosynthetic process
GO:0006351	0.653	DNA-templated transcription
GO:0050794	0.651	regulation of cellular process
GO:0006366	0.641	transcription by RNA polymerase II
GO:0006352	0.565	DNA-templated transcription initiation
GO:0006367	0.536	transcription initiation at RNA polymerase II promoter
GO:0071840	0.534	cellular component organization or biogenesis
GO:0016043	0.523	cellular component organization
GO:0031323	0.368	regulation of cellular metabolic process
GO:0051171	0.353	regulation of nitrogen compound metabolic process
GO:0080090	0.348	regulation of primary metabolic process
GO:0010604	0.343	positive regulation of macromolecule metabolic process
GO:0019219	0.336	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.317	regulation of cellular biosynthetic process
GO:0010556	0.316	regulation of macromolecule biosynthetic process
GO:0070897	0.316	transcription preinitiation complex assembly
GO:0048522	0.309	positive regulation of cellular process
GO:0051252	0.300	regulation of RNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.995	nuclear lumen
GO:0005654	0.982	nucleoplasm
GO:0005737	0.949	cytoplasm
GO:0032991	0.535	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]