StarFunc result for job id A0A1W2PPM1

User Input

>input (405 residues)
MNLDGTSGGFPAEEDHHNEERQTKNKRKTKHRHKFSEELLQELKEIFGENCYPDYTTRKT
LAIKFDCPVNVIDNWFQNKRARLPPAERRRIFVLQKKHDFPVQAHSFLSCQETQAAAHNY
ATKQSLSGAQRALMRRAGCSHLEKQWIPSQEMGYNCFSLENQETPSQQVGPQCSYLEKPG
IPSQQVGSQCSYLEKLGIPSQQVASQSSYLVTGTEKHPGCAMGYGGDTGSGHSGSGHSTA
YHFLSYNSAECLHPPPSSVPYFHGERTETKESQHASPFLLDYAQGAYGVKKDHCLCSFCL
SLLGQQQQNDWQYHLQQHQQPQNYLEGMMLQEQLPMDSGPWDLGKQWSSAQSQLQSQLPQ
NNGKPLCSQLQHMSLQIAADSPLLPLGQDMQERASEQPRTQMQQL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9V490	0.154	0.119	6.777E-5	543	0.165	0.123	Q9V490.pdb.gz	Q9V490_DROME GH14454p OS=Drosophila melanogaster OX=7227 GN=toy PE=2 SV=4
2	AFDB:P25425	0.134	0.076	2.573E-4	770	0.163	0.086	P25425.pdb.gz	PO2F1_MOUSE POU domain, class 2, transcription factor 1 OS=Mus musculus OX=10090 GN=Pou2f1 PE=1 SV=3
3	AFDB:F1NSK6	0.137	0.075	3.113E-4	766	0.146	0.077	F1NSK6.pdb.gz
4	AFDB:P31264	0.141	0.077	3.951E-3	782	0.185	0.096	P31264.pdb.gz	HMPB_DROME Homeotic protein proboscipedia OS=Drosophila melanogaster OX=7227 GN=pb PE=2 SV=2
5	AFDB:Q9W268	0.132	0.055	4.486E-3	1024	0.158	0.062	Q9W268.pdb.gz	Q9W268_DROME Defective proventriculus, isoform A OS=Drosophila melanogaster OX=7227 GN=dve PE=2 SV=1
6	AFDB:Q38DR9	0.084	0.066	1.598E-2	545	0.170	0.127	Q38DR9.pdb.gz	Q38DR9_TRYB2 4E-interacting protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.2380 PE=4 SV=1
7	AFDB:F1QPM7	0.116	0.050	6.067E-2	1078	0.126	0.047	F1QPM7.pdb.gz
8	PDB:4egcA	0.114	0.086	7.166E-2	539	0.035	0.026	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
9	AFDB:P37275	0.142	0.059	1.300E-1	1124	0.131	0.047	P37275.pdb.gz	ZEB1_HUMAN Zinc finger E-box-binding homeobox 1 OS=Homo sapiens OX=9606 GN=ZEB1 PE=1 SV=2
10	PDB:2hi3A	0.111	0.462	1.744E-1	73	0.035	0.192	2hi3A.pdb.gz
11	AFDB:Q94LW1	0.118	0.081	2.028E-1	631	0.158	0.101	Q94LW1.pdb.gz	Q94LW1_MAIZE Two-component response regulator OS=Zea mays OX=4577 GN=ZmRR9 PE=2 SV=1
12	AFDB:Q9R0G7	0.104	0.041	2.028E-1	1215	0.151	0.050	Q9R0G7.pdb.gz	ZEB2_MOUSE Zinc finger E-box-binding homeobox 2 OS=Mus musculus OX=10090 GN=Zeb2 PE=1 SV=2
13	PDB:5mrca	0.086	0.183	6.620E-1	177	0.037	0.085	5mrca.pdb.gz	The structure of the yeast mitochondrial ribosome.
14	PDB:4x6gE	0.090	0.113	2.358	307	0.022	0.029	4x6gE.pdb.gz
15	PDB:3qyxA	0.067	0.127	2.678	131	0.040	0.122	3qyxA.pdb.gz	Atypical DNA recognition mechanism used by the EspR virulence regulator of Mycobacterium tuberculosis.
16	PDB:3femA	0.089	0.125	3.041	281	0.012	0.018	3femA.pdb.gz
17	PDB:7pikC	0.075	0.057	3.041	557	0.032	0.023	7pikC.pdb.gz	Structural basis of transposon end recognition explains central features of Tn7 transposition systems.
18	PDB:2h09A	0.090	0.235	3.453	127	0.010	0.031	2h09A.pdb.gz
19	PDB:6hxgA	0.078	0.112	3.453	264	0.022	0.034	6hxgA.pdb.gz
20	PDB:7bl58	0.088	0.176	3.679	157	0.040	0.102	7bl58.pdb.gz	Snapshots of native pre-50S ribosomes reveal a biogenesis factor network and evolutionary specialization.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NZR4	4.82e-09	60.1	365	0.081	0.090	VSX1_HUMAN Visual system homeobox 1 OS=Homo sapiens OX=9606 GN=VSX1 PE=1 SV=2
2	Q91V10	5.57e-09	59.7	363	0.081	0.091	VSX1_MOUSE Visual system homeobox 1 OS=Mus musculus OX=10090 GN=Vsx1 PE=1 SV=1
3	P56916	9.73e-09	57.4	201	0.074	0.149	GSC2_MOUSE Homeobox protein goosecoid-2 OS=Mus musculus OX=10090 GN=Gsc2 PE=2 SV=2
4	P54366	1.81e-08	58.2	415	0.059	0.058	GSC_DROME Homeobox protein goosecoid OS=Drosophila melanogaster OX=7227 GN=Gsc PE=2 SV=2
5	O15499	5.36e-08	55.1	205	0.069	0.137	GSC2_HUMAN Homeobox protein goosecoid-2 OS=Homo sapiens OX=9606 GN=GSC2 PE=1 SV=1
6	Q5I7G4	7.30e-08	55.8	284	0.074	0.106	Q5I7G4_DANRE Paired mesoderm homeobox protein 2B OS=Danio rerio OX=7955 GN=phox2b PE=2 SV=1
7	O42250	7.85e-08	56.2	344	0.059	0.070	VSX1_DANRE Visual system homeobox 1 OS=Danio rerio OX=7955 GN=vsx1 PE=1 SV=2
8	F1RCT9	8.92e-08	55.5	280	0.069	0.100	F1RCT9_DANRE Paired mesoderm homeobox protein 2A isoform X1 OS=Danio rerio OX=7955 GN=arix PE=4 SV=1
9	Q6NYV4	9.30e-08	55.5	277	0.069	0.101	Q6NYV4_DANRE Paired mesoderm homeobox protein 2A OS=Danio rerio OX=7955 GN=arix PE=2 SV=1
10	A0A0G2JYE6	9.47e-08	55.5	314	0.069	0.089	A0A0G2JYE6_RAT Paired-like homeobox 2b OS=Rattus norvegicus OX=10116 GN=Phox2b PE=4 SV=2
11	O35690	9.47e-08	55.5	314	0.069	0.089	PHX2B_MOUSE Paired mesoderm homeobox protein 2B OS=Mus musculus OX=10090 GN=Phox2b PE=1 SV=1
12	Q99453	9.47e-08	55.5	314	0.069	0.089	PHX2B_HUMAN Paired mesoderm homeobox protein 2B OS=Homo sapiens OX=9606 GN=PHOX2B PE=1 SV=2
13	O18400	1.05e-07	56.2	509	0.067	0.053	PITX_DROME Pituitary homeobox homolog Ptx1 OS=Drosophila melanogaster OX=7227 GN=Ptx1 PE=2 SV=2
14	Q0P031	3.47e-07	53.9	344	0.059	0.070	VSX1_XENLA Visual system homeobox 1 OS=Xenopus laevis OX=8355 GN=vsx1 PE=2 SV=1
15	Q62782	5.16e-07	53.1	281	0.059	0.085	PHX2A_RAT Paired mesoderm homeobox protein 2A OS=Rattus norvegicus OX=10116 GN=Phox2a PE=2 SV=1
16	Q62066	5.23e-07	53.1	280	0.059	0.086	PHX2A_MOUSE Paired mesoderm homeobox protein 2A OS=Mus musculus OX=10090 GN=Phox2a PE=2 SV=1
17	O14813	5.98e-07	53.1	284	0.059	0.085	PHX2A_HUMAN Paired mesoderm homeobox protein 2A OS=Homo sapiens OX=9606 GN=PHOX2A PE=1 SV=2
18	Q9UBX0	6.74e-07	51.6	185	0.062	0.135	HESX1_HUMAN Homeobox expressed in ES cells 1 OS=Homo sapiens OX=9606 GN=HESX1 PE=1 SV=1
19	Q02591	9.15e-07	52.0	256	0.057	0.090	GSC_MOUSE Homeobox protein goosecoid OS=Mus musculus OX=10090 GN=Gsc PE=1 SV=1
20	P56915	9.40e-07	52.0	257	0.057	0.089	GSC_HUMAN Homeobox protein goosecoid OS=Homo sapiens OX=9606 GN=GSC PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11718 CPSF73-100_C	2.2e+02	12.8	Pre-mRNA 3'-end-processing endonuclease polyadenylation factor C-term
2	PF05920 Homeobox_KN	7.7	17.8	Homeobox KN domain
3	PF00046 Homeodomain	1.4e-08	45.7	Homeodomain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9541.XP_005592650.1

Rank	PPI partner	STRING score	Description
1	9541.XP_005566874.1	0.661	Double homeobox protein 4-like protein 4-like
2	9541.XP_005592642.1	0.611	Specifically deaminates adenosine-37 to inosine in tRNA-Ala.
3	9541.XP_005583211.1	0.608	Double homeobox protein 4-like protein 4-like
4	9541.XP_005547015.1	0.588	Tyrosine-protein phosphatase non-receptor type 23-like isoform X1
5	9541.XP_005569188.1	0.587	Cell surface proteoglycan
6	9541.XP_005547705.1	0.537	Interleukin-5 receptor subunit alpha isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043565	0.997	sequence-specific DNA binding
GO:0003690	0.985	double-stranded DNA binding
GO:1990837	0.984	sequence-specific double-stranded DNA binding
GO:0003700	0.967	DNA-binding transcription factor activity
GO:0000981	0.949	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	0.940	transcription cis-regulatory region binding
GO:0000977	0.861	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.841	regulation of biological process
GO:0050794	0.761	regulation of cellular process
GO:0060255	0.738	regulation of macromolecule metabolic process
GO:0051252	0.548	regulation of RNA metabolic process
GO:0009889	0.543	regulation of biosynthetic process
GO:0010468	0.528	regulation of gene expression
GO:0032502	0.319	developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0043232	0.923	intracellular non-membrane-bounded organelle
GO:0031981	0.890	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]