StarFunc result for job id A0A1W2PPW3

User Input

>input (197 residues)
METGRQRGASAEMFAMPQGLKGSNKDGIPEDLDGNLEEPRDQESELRSQDVMDLTEGDNE
ASASAPPAAKRQKTDTKGKKERKPTVDAEEAQMTTLLYAMSEEQLSRYEVCRRSAFPKAR
IAALMQSITGRSVSENTAIAMAGIAKVLVGEVVEEALDVCEMWGETPPLQPKHLREAVRR
LKPKGLFPNSNYKKIMF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15544	0.546	0.512	2.729E-15	211	0.604	0.564	Q15544.pdb.gz	TAF11_HUMAN Transcription initiation factor TFIID subunit 11 OS=Homo sapiens OX=9606 GN=TAF11 PE=1 SV=1
2	AFDB:Q99JX1	0.575	0.539	4.217E-15	211	0.563	0.526	Q99JX1.pdb.gz	TAF11_MOUSE Transcription initiation factor TFIID subunit 11 OS=Mus musculus OX=10090 GN=Taf11 PE=1 SV=1
3	AFDB:P49906	0.542	0.545	7.366E-13	196	0.386	0.388	P49906.pdb.gz	TAF11_DROME Transcription initiation factor TFIID subunit 11 OS=Drosophila melanogaster OX=7227 GN=Taf11 PE=1 SV=1
4	PDB:7edxk	0.456	0.883	7.525E-11	98	0.376	0.755	7edxk.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
5	AFDB:Q9US54	0.473	0.469	1.457E-10	199	0.299	0.296	Q9US54.pdb.gz	TAF11_SCHPO Transcription initiation factor TFIID subunit 11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=taf11 PE=3 SV=1
6	AFDB:A0A3B3ITY8	0.357	0.352	4.194E-10	200	0.462	0.455	A0A3B3ITY8.pdb.gz	A0A3B3ITY8_HUMAN TATA-box binding protein associated factor 11 OS=Homo sapiens OX=9606 GN=TAF11 PE=1 SV=1
7	AFDB:Q9M565	0.514	0.483	5.718E-9	210	0.289	0.271	Q9M565.pdb.gz	TAF11_ARATH Transcription initiation factor TFIID subunit 11 OS=Arabidopsis thaliana OX=3702 GN=TAF11 PE=1 SV=1
8	PDB:1bfmA	0.326	0.862	6.189E-3	69	0.076	0.217	1bfmA.pdb.gz
9	PDB:2rvqC	0.329	0.462	1.227E-2	133	0.112	0.165	2rvqC.pdb.gz
10	PDB:2rvqD	0.319	0.471	1.227E-2	129	0.112	0.171	2rvqD.pdb.gz
11	PDB:1b67A	0.322	0.887	1.478E-2	68	0.071	0.206	1b67A.pdb.gz
12	PDB:7egdF	0.329	0.159	1.674E-2	412	0.051	0.024	7egdF.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
13	PDB:5z30G	0.302	0.510	1.896E-2	110	0.107	0.191	5z30G.pdb.gz	Cancer-associated mutations of histones H2B, H3.1 and H2A.Z.1 affect the structure and stability of the nucleosome.
14	PDB:4draH	0.314	0.742	2.285E-2	76	0.066	0.171	4draH.pdb.gz
15	PDB:1jfiB	0.333	0.477	4.530E-2	135	0.056	0.081	1jfiB.pdb.gz	Crystal structure of negative cofactor 2 recognizing the TBP-DNA transcription complex.
16	PDB:3b0bC	0.311	0.746	4.820E-2	75	0.066	0.173	3b0bC.pdb.gz
17	AFDB:Q9U226	0.322	0.190	6.838E-2	342	0.117	0.067	Q9U226.pdb.gz	TAF12_CAEEL Transcription initiation factor TFIID subunit 12 OS=Caenorhabditis elegans OX=6239 GN=taf-12 PE=1 SV=2
18	AFDB:Q12962	0.294	0.268	1.197E-1	218	0.157	0.142	Q12962.pdb.gz	TAF10_HUMAN Transcription initiation factor TFIID subunit 10 OS=Homo sapiens OX=9606 GN=TAF10 PE=1 SV=1
19	AFDB:Q9W3V9	0.326	0.115	1.197E-1	601	0.137	0.045	Q9W3V9.pdb.gz	Q9W3V9_DROME Nuclear factor Y-box C OS=Drosophila melanogaster OX=7227 GN=Nf-YC PE=1 SV=1
20	AFDB:Q651K2	0.197	0.143	1.634E-1	294	0.157	0.105	Q651K2.pdb.gz	Q651K2_ORYSJ Os06g0496400 protein OS=Oryza sativa subsp. japonica OX=39947 GN=Os06g0496400 PE=3 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q15544	8.37e-66	203	211	0.604	0.564	TAF11_HUMAN Transcription initiation factor TFIID subunit 11 OS=Homo sapiens OX=9606 GN=TAF11 PE=1 SV=1
2	Q99JX1	2.16e-64	199	211	0.604	0.564	TAF11_MOUSE Transcription initiation factor TFIID subunit 11 OS=Mus musculus OX=10090 GN=Taf11 PE=1 SV=1
3	P49906	7.62e-37	129	196	0.325	0.327	TAF11_DROME Transcription initiation factor TFIID subunit 11 OS=Drosophila melanogaster OX=7227 GN=Taf11 PE=1 SV=1
4	A0A3B3ITY8	8.89e-37	128	200	0.442	0.435	A0A3B3ITY8_HUMAN TATA-box binding protein associated factor 11 OS=Homo sapiens OX=9606 GN=TAF11 PE=1 SV=1
5	Q9US54	2.21e-22	91.7	199	0.228	0.226	TAF11_SCHPO Transcription initiation factor TFIID subunit 11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=taf11 PE=3 SV=1
6	Q9M565	3.69e-16	75.5	210	0.213	0.200	TAF11_ARATH Transcription initiation factor TFIID subunit 11 OS=Arabidopsis thaliana OX=3702 GN=TAF11 PE=1 SV=1
7	Q04226	3.75e-08	54.3	346	0.102	0.058	TAF11_YEAST Transcription initiation factor TFIID subunit 11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TAF11 PE=1 SV=1
8	Q86XD5	0.92	32.3	332	0.056	0.033	F131B_HUMAN Protein FAM131B OS=Homo sapiens OX=9606 GN=FAM131B PE=1 SV=3
9	P38356	2.5	31.2	321	0.127	0.078	BSD2_YEAST Metal homeostatis protein BSD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BSD2 PE=1 SV=1
10	Q09879	5.8	30.0	1108	0.127	0.023	UBP72_SCHPO Ubiquitin carboxyl-terminal hydrolase 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp5 PE=1 SV=3
11	Q9VNA6	5.8	30.0	687	0.122	0.035	Q9VNA6_DROME Ceramide kinase, isoform A OS=Drosophila melanogaster OX=7227 GN=Cerk PE=2 SV=2
12	Q582J0	7.6	29.6	1063	0.173	0.032	Q582J0_TRYB2 Anaphase-promoting complex subunit 5 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.10C21.230 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00808 CBFD_NFYB_HMF	10	17.8	Histone-like transcription factor (CBF/NF-Y) and archaeal histone
2	PF14695 LINES_C	1.9e+02	12.9	Lines C-terminus
3	PF04719 TAFII28	1.8e-27	106.5	hTAFII28-like protein conserved region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000020670

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000002710	0.924	TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa
2	9593.ENSGGOP00000007336	0.924	TAF2 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 150kDa
3	9593.ENSGGOP00000000388	0.921	Transcription initiation factor TFIID subunit 10
4	9593.ENSGGOP00000008371	0.914	TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa
5	9593.ENSGGOP00000008899	0.913	TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa
6	9593.ENSGGOP00000005330	0.889	TAF5 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 100kDa
7	9593.ENSGGOP00000027533	0.888	TAF8 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 43kDa
8	9593.ENSGGOP00000016296	0.883	TAF3 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 140kDa
9	9593.ENSGGOP00000002080	0.859	Uncharacterized protein
10	9593.ENSGGOP00000003902	0.859	TAF4b RNA polymerase II, TATA box binding protein (TBP)-associated factor, 105kDa
11	9593.ENSGGOP00000009307	0.855	Uncharacterized protein
12	9593.ENSGGOP00000023578	0.855	Uncharacterized protein
13	9593.ENSGGOP00000001038	0.851	TATA box binding protein like 2
14	9593.ENSGGOP00000002430	0.851	TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa
15	9593.ENSGGOP00000004050	0.851	TATA-box binding protein associated factor 9
16	9593.ENSGGOP00000011550	0.851	TATA box binding protein
17	9593.ENSGGOP00000015303	0.851	Transcription initiation factor TFIID subunit
18	9593.ENSGGOP00000026097	0.851	Transcription initiation factor TFIID subunit
19	9593.ENSGGOP00000018571	0.846	TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa
20	9593.ENSGGOP00000011524	0.836	TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016251	0.949	RNA polymerase II general transcription initiation factor activity
GO:0140110	0.846	transcription regulator activity
GO:0008134	0.836	transcription factor binding
GO:0097159	0.737	organic cyclic compound binding
GO:1901363	0.735	heterocyclic compound binding
GO:0003676	0.719	nucleic acid binding
GO:0003677	0.691	DNA binding
GO:0061629	0.356	RNA polymerase II-specific DNA-binding transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048518	0.986	positive regulation of biological process
GO:0060255	0.975	regulation of macromolecule metabolic process
GO:0010468	0.974	regulation of gene expression
GO:0009987	0.967	cellular process
GO:0050794	0.936	regulation of cellular process
GO:0071704	0.916	organic substance metabolic process
GO:0044237	0.915	cellular metabolic process
GO:0044238	0.904	primary metabolic process
GO:0006807	0.890	nitrogen compound metabolic process
GO:1901576	0.885	organic substance biosynthetic process
GO:0046483	0.884	heterocycle metabolic process
GO:0043170	0.876	macromolecule metabolic process
GO:1901362	0.875	organic cyclic compound biosynthetic process
GO:0044249	0.872	cellular biosynthetic process
GO:0006139	0.869	nucleobase-containing compound metabolic process
GO:0034654	0.864	nucleobase-containing compound biosynthetic process
GO:0009059	0.863	macromolecule biosynthetic process
GO:0006351	0.853	DNA-templated transcription
GO:0006366	0.822	transcription by RNA polymerase II
GO:0009893	0.766	positive regulation of metabolic process
GO:0010604	0.764	positive regulation of macromolecule metabolic process
GO:0048522	0.714	positive regulation of cellular process
GO:0071840	0.695	cellular component organization or biogenesis
GO:0019219	0.691	regulation of nucleobase-containing compound metabolic process
GO:0016043	0.688	cellular component organization
GO:0006352	0.646	DNA-templated transcription initiation
GO:0006367	0.638	transcription initiation at RNA polymerase II promoter
GO:0051252	0.637	regulation of RNA metabolic process
GO:0051173	0.580	positive regulation of nitrogen compound metabolic process
GO:0031325	0.580	positive regulation of cellular metabolic process
GO:0051254	0.535	positive regulation of RNA metabolic process
GO:0010556	0.524	regulation of macromolecule biosynthetic process
GO:0031326	0.524	regulation of cellular biosynthetic process
GO:1903506	0.514	regulation of nucleic acid-templated transcription
GO:0006355	0.493	regulation of DNA-templated transcription
GO:0010557	0.440	positive regulation of macromolecule biosynthetic process
GO:0031328	0.440	positive regulation of cellular biosynthetic process
GO:1903508	0.430	positive regulation of nucleic acid-templated transcription
GO:0045893	0.422	positive regulation of DNA-templated transcription
GO:0006357	0.406	regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005575	1.000	cellular_component
GO:0031981	0.987	nuclear lumen
GO:0005654	0.982	nucleoplasm
GO:0032991	0.970	protein-containing complex
GO:1902494	0.953	catalytic complex
GO:0061695	0.939	transferase complex, transferring phosphorus-containing groups
GO:0016591	0.925	RNA polymerase II, holoenzyme
GO:0005667	0.913	transcription regulator complex
GO:0090575	0.903	RNA polymerase II transcription regulator complex
GO:0005737	0.819	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]