StarFunc result for job id A0A1W2PQ09

User Input

>input (198 residues)
METGRQRDASAEMFPMPRGLKYSNKDGIPEDLDGNLEEPRDQESELRSQDVMDLTEGDNE
ASASTPPSAKRQKTDTKGKKERKPTMDAEEAQRMTTLFSAMSEEQLSRYEVCRRSAFPKA
RIAALMQSITGRSVSENTAIAMAGIAKVFVGEVVEEALDVCEMWGETPPLQPKHLREAVR
RLKPKGILPNSNYKKIMF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15544	0.533	0.502	4.562E-16	211	0.591	0.555	Q15544.pdb.gz	TAF11_HUMAN Transcription initiation factor TFIID subunit 11 OS=Homo sapiens OX=9606 GN=TAF11 PE=1 SV=1
2	AFDB:Q99JX1	0.574	0.540	9.127E-16	211	0.581	0.545	Q99JX1.pdb.gz	TAF11_MOUSE Transcription initiation factor TFIID subunit 11 OS=Mus musculus OX=10090 GN=Taf11 PE=1 SV=1
3	AFDB:P49906	0.543	0.548	9.985E-13	196	0.404	0.408	P49906.pdb.gz	TAF11_DROME Transcription initiation factor TFIID subunit 11 OS=Drosophila melanogaster OX=7227 GN=Taf11 PE=1 SV=1
4	PDB:7edxk	0.454	0.885	7.052E-11	98	0.379	0.765	7edxk.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
5	AFDB:A0A3B3ITY8	0.366	0.363	8.774E-11	200	0.449	0.445	A0A3B3ITY8.pdb.gz	A0A3B3ITY8_HUMAN TATA-box binding protein associated factor 11 OS=Homo sapiens OX=9606 GN=TAF11 PE=1 SV=1
6	AFDB:Q9US54	0.478	0.476	1.060E-10	199	0.293	0.291	Q9US54.pdb.gz	TAF11_SCHPO Transcription initiation factor TFIID subunit 11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=taf11 PE=3 SV=1
7	AFDB:Q9M565	0.518	0.490	2.479E-9	210	0.278	0.262	Q9M565.pdb.gz	TAF11_ARATH Transcription initiation factor TFIID subunit 11 OS=Arabidopsis thaliana OX=3702 GN=TAF11 PE=1 SV=1
8	PDB:1bfmA	0.324	0.860	5.081E-3	69	0.076	0.217	1bfmA.pdb.gz
9	PDB:7egdF	0.326	0.159	8.413E-3	412	0.051	0.024	7egdF.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
10	PDB:5z30G	0.300	0.509	1.228E-2	110	0.111	0.200	5z30G.pdb.gz	Cancer-associated mutations of histones H2B, H3.1 and H2A.Z.1 affect the structure and stability of the nucleosome.
11	PDB:1b67A	0.320	0.884	1.683E-2	68	0.071	0.206	1b67A.pdb.gz
12	PDB:4draH	0.314	0.751	1.683E-2	76	0.071	0.184	4draH.pdb.gz
13	PDB:5y26B	0.303	0.621	2.166E-2	92	0.051	0.109	5y26B.pdb.gz
14	PDB:5y27A	0.331	0.639	2.166E-2	98	0.066	0.133	5y27A.pdb.gz
15	PDB:2rvqD	0.314	0.466	2.457E-2	129	0.101	0.155	2rvqD.pdb.gz
16	AFDB:Q9U226	0.327	0.194	2.695E-2	342	0.152	0.088	Q9U226.pdb.gz	TAF12_CAEEL Transcription initiation factor TFIID subunit 12 OS=Caenorhabditis elegans OX=6239 GN=taf-12 PE=1 SV=2
17	PDB:4h9sA	0.295	0.590	3.820E-2	89	0.071	0.157	4h9sA.pdb.gz
18	AFDB:Q8IHQ2	0.339	0.056	4.463E-2	1301	0.131	0.020	Q8IHQ2.pdb.gz	Q8IHQ2_PLAF7 Oocyst rupture protein 1, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1146600 PE=3 SV=1
19	AFDB:P49905	0.313	0.316	6.116E-2	196	0.126	0.128	P49905.pdb.gz	TAF12_DROME Transcription initiation factor TFIID subunit 12 OS=Drosophila melanogaster OX=7227 GN=Taf12 PE=1 SV=1
20	AFDB:Q9W3V9	0.329	0.114	6.514E-2	601	0.157	0.052	Q9W3V9.pdb.gz	Q9W3V9_DROME Nuclear factor Y-box C OS=Drosophila melanogaster OX=7227 GN=Nf-YC PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q15544	3.71e-66	204	211	0.596	0.559	TAF11_HUMAN Transcription initiation factor TFIID subunit 11 OS=Homo sapiens OX=9606 GN=TAF11 PE=1 SV=1
2	Q99JX1	8.23e-66	203	211	0.586	0.550	TAF11_MOUSE Transcription initiation factor TFIID subunit 11 OS=Mus musculus OX=10090 GN=Taf11 PE=1 SV=1
3	P49906	1.77e-38	133	196	0.333	0.337	TAF11_DROME Transcription initiation factor TFIID subunit 11 OS=Drosophila melanogaster OX=7227 GN=Taf11 PE=1 SV=1
4	A0A3B3ITY8	2.86e-37	130	200	0.429	0.425	A0A3B3ITY8_HUMAN TATA-box binding protein associated factor 11 OS=Homo sapiens OX=9606 GN=TAF11 PE=1 SV=1
5	Q9US54	1.06e-22	92.4	199	0.232	0.231	TAF11_SCHPO Transcription initiation factor TFIID subunit 11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=taf11 PE=3 SV=1
6	Q9M565	5.70e-17	77.4	210	0.212	0.200	TAF11_ARATH Transcription initiation factor TFIID subunit 11 OS=Arabidopsis thaliana OX=3702 GN=TAF11 PE=1 SV=1
7	Q04226	7.20e-08	53.5	346	0.116	0.066	TAF11_YEAST Transcription initiation factor TFIID subunit 11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TAF11 PE=1 SV=1
8	Q86XD5	0.96	32.3	332	0.056	0.033	F131B_HUMAN Protein FAM131B OS=Homo sapiens OX=9606 GN=FAM131B PE=1 SV=3
9	A0A1S4NYG1	1.2	32.3	1582	0.136	0.017	A0A1S4NYG1_MESAU SUR1 OS=Mesocricetus auratus OX=10036 PE=1 SV=1
10	A0A1U7R319	1.2	32.3	1582	0.136	0.017	A0A1U7R319_MESAU ATP-binding cassette sub-family C member 8 isoform X2 OS=Mesocricetus auratus OX=10036 GN=Abcc8 PE=1 SV=1
11	Q9SYZ9	3.4	30.8	353	0.111	0.062	TAF8_ARATH Transcription initiation factor TFIID subunit 8 OS=Arabidopsis thaliana OX=3702 GN=TAF8 PE=1 SV=1
12	G3I1T3	3.5	30.8	2352	0.096	0.008	G3I1T3_CRIGR ATP-sensitive inward rectifier potassium channel 11 (Fragment) OS=Cricetulus griseus OX=10029 GN=I79_017352 PE=1 SV=1
13	Q8BNE2	3.8	30.8	1087	0.096	0.017	Q8BNE2_MOUSE ATP-binding cassette sub-family C member 8 OS=Mus musculus OX=10090 GN=Abcc8 PE=2 SV=1
14	B2RUS7	4.1	30.8	1588	0.096	0.012	B2RUS7_MOUSE ATP-binding cassette, sub-family C (CFTR/MRP), member 8 OS=Mus musculus OX=10090 GN=Abcc8 PE=1 SV=1
15	P38244	5.2	30.4	976	0.096	0.019	PFF1_YEAST Vacuolar membrane protease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PFF1 PE=1 SV=3
16	Q9UUB5	6.7	29.6	329	0.177	0.106	MIS13_SCHPO Kinetochore protein mis13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mis13 PE=1 SV=1
17	Q9QXE0	8.9	29.6	581	0.051	0.017	HACL1_MOUSE 2-hydroxyacyl-CoA lyase 1 OS=Mus musculus OX=10090 GN=Hacl1 PE=1 SV=2
18	Q09428	9.1	29.6	1581	0.091	0.011	ABCC8_HUMAN ATP-binding cassette sub-family C member 8 OS=Homo sapiens OX=9606 GN=ABCC8 PE=1 SV=6
19	Q2UR38	9.2	29.6	798	0.106	0.026	XYND_ASPOR Exo-1,4-beta-xylosidase xlnD OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=xlnD PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00808 CBFD_NFYB_HMF	0.48	22.0	Histone-like transcription factor (CBF/NF-Y) and archaeal histone
2	PF04719 TAFII28	3.9e-29	111.9	hTAFII28-like protein conserved region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000020670

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000002710	0.924	TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa
2	9593.ENSGGOP00000007336	0.924	TAF2 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 150kDa
3	9593.ENSGGOP00000000388	0.921	Transcription initiation factor TFIID subunit 10
4	9593.ENSGGOP00000008371	0.914	TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa
5	9593.ENSGGOP00000008899	0.913	TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa
6	9593.ENSGGOP00000005330	0.889	TAF5 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 100kDa
7	9593.ENSGGOP00000027533	0.888	TAF8 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 43kDa
8	9593.ENSGGOP00000016296	0.883	TAF3 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 140kDa
9	9593.ENSGGOP00000002080	0.859	Uncharacterized protein
10	9593.ENSGGOP00000003902	0.859	TAF4b RNA polymerase II, TATA box binding protein (TBP)-associated factor, 105kDa
11	9593.ENSGGOP00000009307	0.855	Uncharacterized protein
12	9593.ENSGGOP00000023578	0.855	Uncharacterized protein
13	9593.ENSGGOP00000001038	0.851	TATA box binding protein like 2
14	9593.ENSGGOP00000002430	0.851	TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa
15	9593.ENSGGOP00000004050	0.851	TATA-box binding protein associated factor 9
16	9593.ENSGGOP00000011550	0.851	TATA box binding protein
17	9593.ENSGGOP00000015303	0.851	Transcription initiation factor TFIID subunit
18	9593.ENSGGOP00000026097	0.851	Transcription initiation factor TFIID subunit
19	9593.ENSGGOP00000018571	0.846	TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa
20	9593.ENSGGOP00000011524	0.836	TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016251	0.897	RNA polymerase II general transcription initiation factor activity
GO:0140110	0.875	transcription regulator activity
GO:0008134	0.825	transcription factor binding
GO:1901363	0.775	heterocyclic compound binding
GO:0097159	0.764	organic cyclic compound binding
GO:0003676	0.734	nucleic acid binding
GO:0003677	0.655	DNA binding
GO:0003713	0.499	transcription coactivator activity
GO:0061629	0.306	RNA polymerase II-specific DNA-binding transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.995	biological regulation
GO:0050789	0.989	regulation of biological process
GO:0010468	0.979	regulation of gene expression
GO:0048518	0.977	positive regulation of biological process
GO:0009987	0.966	cellular process
GO:0050794	0.935	regulation of cellular process
GO:0071704	0.911	organic substance metabolic process
GO:0044238	0.906	primary metabolic process
GO:0044237	0.906	cellular metabolic process
GO:0006807	0.893	nitrogen compound metabolic process
GO:1901576	0.888	organic substance biosynthetic process
GO:0043170	0.886	macromolecule metabolic process
GO:0044249	0.884	cellular biosynthetic process
GO:1901362	0.877	organic cyclic compound biosynthetic process
GO:0006139	0.877	nucleobase-containing compound metabolic process
GO:0009059	0.875	macromolecule biosynthetic process
GO:0006351	0.867	DNA-templated transcription
GO:0006366	0.808	transcription by RNA polymerase II
GO:0009893	0.801	positive regulation of metabolic process
GO:0031323	0.790	regulation of cellular metabolic process
GO:0080090	0.785	regulation of primary metabolic process
GO:0048522	0.770	positive regulation of cellular process
GO:0010604	0.767	positive regulation of macromolecule metabolic process
GO:0019219	0.727	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.709	regulation of RNA metabolic process
GO:0009889	0.708	regulation of biosynthetic process
GO:2001141	0.685	regulation of RNA biosynthetic process
GO:0006367	0.640	transcription initiation at RNA polymerase II promoter
GO:0006355	0.618	regulation of DNA-templated transcription
GO:0016043	0.585	cellular component organization
GO:0031325	0.571	positive regulation of cellular metabolic process
GO:0051173	0.570	positive regulation of nitrogen compound metabolic process
GO:0045935	0.514	positive regulation of nucleobase-containing compound metabolic process
GO:0051254	0.503	positive regulation of RNA metabolic process
GO:1903508	0.425	positive regulation of nucleic acid-templated transcription
GO:0045893	0.418	positive regulation of DNA-templated transcription
GO:0006357	0.411	regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005575	1.000	cellular_component
GO:0005634	0.992	nucleus
GO:0005654	0.980	nucleoplasm
GO:0032991	0.970	protein-containing complex
GO:1902494	0.949	catalytic complex
GO:0061695	0.924	transferase complex, transferring phosphorus-containing groups
GO:0090575	0.905	RNA polymerase II transcription regulator complex
GO:0055029	0.902	nuclear DNA-directed RNA polymerase complex
GO:0016591	0.851	RNA polymerase II, holoenzyme
GO:0005737	0.808	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]