StarFunc result for job id A0A1W2PQ72

User Input

>input (361 residues)
MASANSSAGIRWSRQETRTLLSILGEAEYIQRLQTVHHNADVYQAVSKRMQQEGFRRTER
QCRSKFKVLKALYLKAYVAHATSMGEPPHCPFYDTLDQLLRNQIVTDPDNLMEDAAWAKH
CDQNLVASDAPGEEGTGILKSKRTQAADHQPILKTVKASDEDCQLRISDRIRETSDLEDS
WDESSGAGCSQGTPSYSSSHSLFRGAVAPCQSSPMARLGVSGEPSPCTSTNRSTPGVAST
PQTPVSSSRAGFVSGGDRPLTSEPPPRWARRRRRSVARTIAAELAENRRLARELSKREEE
KLDRLIAIGEEASAQQDTANELRRDAVIAVRRLATAVEEATGAFQLGLEKLLQRLISNTK
S

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0A0MPG9	0.236	0.085	4.904E-5	1042	0.188	0.065	A0A0A0MPG9.pdb.gz
2	AFDB:Q9LJG8	0.233	0.193	6.691E-3	443	0.144	0.117	Q9LJG8.pdb.gz	ASIL2_ARATH Trihelix transcription factor ASIL2 OS=Arabidopsis thaliana OX=3702 GN=ASIL2 PE=1 SV=1
3	AFDB:Q9VB49	0.237	0.116	1.809E-2	775	0.155	0.072	Q9VB49.pdb.gz	Q9VB49_DROME Martik, isoform A OS=Drosophila melanogaster OX=7227 GN=mrt PE=4 SV=1
4	AFDB:P23250	0.172	0.154	2.424E-2	407	0.130	0.115	P23250.pdb.gz	RPI1_YEAST Negative RAS protein regulator protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPI1 PE=1 SV=2
5	AFDB:Q10274	0.139	0.130	4.105E-2	390	0.122	0.113	Q10274.pdb.gz	TEB1_SCHPO Telobox protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=teb1 PE=1 SV=1
6	AFDB:Q9VBP5	0.201	0.214	1.488E-1	336	0.133	0.143	Q9VBP5.pdb.gz	Q9VBP5_DROME Jing interacting gene regulatory 1, isoform A OS=Drosophila melanogaster OX=7227 GN=jigr1 PE=1 SV=1
7	AFDB:Q9C695	0.122	0.137	3.579E-1	314	0.127	0.146	Q9C695.pdb.gz	Q9C695_ARATH At1g57560 OS=Arabidopsis thaliana OX=3702 GN=MYB50 PE=1 SV=1
8	AFDB:Q7JUZ9	0.198	0.200	6.060E-1	358	0.125	0.126	Q7JUZ9.pdb.gz	Q7JUZ9_DROME Corepressor of pangolin, isoform A OS=Drosophila melanogaster OX=7227 GN=Coop PE=1 SV=1
9	AFDB:Q9SJM4	0.188	0.168	7.224E-1	414	0.086	0.075	Q9SJM4.pdb.gz	STKLI_ARATH GLABROUS1 enhancer-binding protein-like 3 OS=Arabidopsis thaliana OX=3702 GN=GPL3 PE=1 SV=1
10	AFDB:Q9FDW1	0.130	0.151	7.659E-1	305	0.144	0.170	Q9FDW1.pdb.gz	MYB44_ARATH Transcription factor MYB44 OS=Arabidopsis thaliana OX=3702 GN=MYB44 PE=1 SV=1
11	PDB:6id0L	0.137	0.106	7.955E-1	475	0.078	0.059	6id0L.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
12	PDB:5yzgL	0.112	0.098	1.605	419	0.089	0.076	5yzgL.pdb.gz	Structure of a human catalytic step I spliceosome
13	PDB:6k15H	0.133	0.123	1.805	393	0.047	0.043	6k15H.pdb.gz	Structure of the RSC complex bound to the nucleosome.
14	PDB:1qqeA	0.119	0.139	2.029	281	0.055	0.071	1qqeA.pdb.gz
15	PDB:3wqyA	0.106	0.054	2.151	905	0.069	0.028	3wqyA.pdb.gz	The selective tRNA aminoacylation mechanism based on a single G.U pair
16	PDB:7acoB	0.172	0.289	2.564	180	0.047	0.094	7acoB.pdb.gz
17	PDB:6v8oO	0.092	0.087	2.719	384	0.058	0.055	6v8oO.pdb.gz	Architecture of the chromatin remodeler RSC and insights into its nucleosome engagement.
18	PDB:7r0cA	0.077	0.090	2.882	284	0.053	0.067	7r0cA.pdb.gz	Structure of the vasopressin hormone-V2 receptor-beta-arrestin1 ternary complex.
19	PDB:7d5sA5	0.091	0.071	3.056	514	0.058	0.041	7d5sA5.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
20	PDB:7sp4u	0.104	0.188	3.056	158	0.042	0.095	7sp4u.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8IWY8	2.37e-22	100	852	0.144	0.061	ZSC29_HUMAN Zinc finger and SCAN domain-containing protein 29 OS=Homo sapiens OX=9606 GN=ZSCAN29 PE=1 SV=2
2	P17040	1.31e-18	89.7	1043	0.127	0.044	ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens OX=9606 GN=ZSCAN20 PE=1 SV=3
3	Q9NX65	8.08e-14	75.1	697	0.122	0.063	ZSC32_HUMAN Zinc finger and SCAN domain-containing protein 32 OS=Homo sapiens OX=9606 GN=ZSCAN32 PE=1 SV=3
4	F1QGF1	4.60e-11	66.6	1111	0.089	0.029	F1QGF1_DANRE Uncharacterized protein LOC503753 OS=Danio rerio OX=7955 GN=zgc:113263 PE=1 SV=3
5	Q9LZS0	1.63e-04	45.8	591	0.086	0.052	PTL_ARATH Trihelix transcription factor PTL OS=Arabidopsis thaliana OX=3702 GN=PTL PE=1 SV=1
6	Q9LU92	2.26e-04	45.1	372	0.072	0.070	TGT4_ARATH Trihelix transcription factor GT-4 OS=Arabidopsis thaliana OX=3702 GN=GT-4 PE=2 SV=1
7	Q9SDW0	5.53e-04	43.9	323	0.078	0.087	TGT3A_ARATH Trihelix transcription factor GT-3a OS=Arabidopsis thaliana OX=3702 GN=GT-3A PE=1 SV=1
8	O80450	7.59e-04	43.1	289	0.066	0.083	TGT3B_ARATH Trihelix transcription factor GT-3b OS=Arabidopsis thaliana OX=3702 GN=GT-3B PE=1 SV=1
9	Q39117	0.001	43.1	575	0.058	0.037	TGT2_ARATH Trihelix transcription factor GT-2 OS=Arabidopsis thaliana OX=3702 GN=GT-2 PE=1 SV=1
10	Q9C882	0.001	42.7	587	0.061	0.037	GTL1_ARATH Trihelix transcription factor GTL1 OS=Arabidopsis thaliana OX=3702 GN=GTL1 PE=1 SV=2
11	Q9C6K3	0.006	40.8	603	0.078	0.046	DF1_ARATH Trihelix transcription factor DF1 OS=Arabidopsis thaliana OX=3702 GN=DF1 PE=4 SV=1
12	Q700D8	0.025	38.9	481	0.058	0.044	Q700D8_ARATH At3g10000 OS=Arabidopsis thaliana OX=3702 GN=EDA31 PE=2 SV=1
13	Q5T230	0.15	36.2	341	0.055	0.059	UTF1_HUMAN Undifferentiated embryonic cell transcription factor 1 OS=Homo sapiens OX=9606 GN=UTF1 PE=1 SV=1
14	P23250	0.21	35.8	407	0.050	0.044	RPI1_YEAST Negative RAS protein regulator protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPI1 PE=1 SV=2
15	M9PG56	0.22	36.2	848	0.066	0.028	M9PG56_DROME Uncharacterized protein, isoform G OS=Drosophila melanogaster OX=7227 GN=CG13812 PE=1 SV=1
16	Q8H181	0.22	35.8	619	0.058	0.034	GTL2_ARATH Trihelix transcription factor GTL2 OS=Arabidopsis thaliana OX=3702 GN=At5g28300 PE=2 SV=1
17	Q00756	0.23	36.2	1109	0.105	0.034	PPR3A_RABIT Protein phosphatase 1 regulatory subunit 3A OS=Oryctolagus cuniculus OX=9986 GN=PPP1R3A PE=1 SV=1
18	M9PFQ9	0.26	35.8	1412	0.066	0.017	M9PFQ9_DROME Uncharacterized protein, isoform E OS=Drosophila melanogaster OX=7227 GN=CG13811 PE=1 SV=1
19	B7Z086	0.32	35.8	1445	0.066	0.017	B7Z086_DROME Uncharacterized protein, isoform D OS=Drosophila melanogaster OX=7227 GN=CG7323 PE=1 SV=1
20	B7Z087	0.32	35.8	1480	0.066	0.016	B7Z087_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=CG13811 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10011 DUF2254	3.9e+02	11.2	Predicted membrane protein (DUF2254)
2	PF00249 Myb_DNA-binding	1.4	20.5	Myb-like DNA-binding domain
3	PF12776 Myb_DNA-bind_3	4.3e+02	13.3	Myb/SANT-like DNA-binding domain
4	PF13837 Myb_DNA-bind_4	2.1e-13	61.8	Myb/SANT-like DNA-binding domain
5	PF13921 Myb_DNA-bind_6	2.6e+02	13.3	Myb-like DNA-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9361.ENSDNOP00000032244

Rank	PPI partner	STRING score	Description
1	9361.ENSDNOP00000007737	0.647	CREB binding protein
2	9361.ENSDNOP00000010363	0.548	Lysine (K)-specific demethylase 1A
3	9361.ENSDNOP00000021613	0.506	Histone cluster 1, H3b
4	9361.ENSDNOP00000025631	0.506	annotation not available

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0003677	0.557	DNA binding
GO:0000976	0.529	transcription cis-regulatory region binding
GO:0140110	0.380	transcription regulator activity
GO:0042802	0.351	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.991	regulation of cellular process
GO:0009889	0.990	regulation of biosynthetic process
GO:0060255	0.988	regulation of macromolecule metabolic process
GO:0080090	0.986	regulation of primary metabolic process
GO:0006355	0.962	regulation of DNA-templated transcription
GO:0048518	0.803	positive regulation of biological process
GO:0048522	0.790	positive regulation of cellular process
GO:0006357	0.563	regulation of transcription by RNA polymerase II
GO:0009893	0.537	positive regulation of metabolic process
GO:0010604	0.490	positive regulation of macromolecule metabolic process
GO:0045935	0.490	positive regulation of nucleobase-containing compound metabolic process
GO:0051254	0.437	positive regulation of RNA metabolic process
GO:0031328	0.436	positive regulation of cellular biosynthetic process
GO:1902680	0.426	positive regulation of RNA biosynthetic process
GO:0045893	0.400	positive regulation of DNA-templated transcription
GO:0048519	0.399	negative regulation of biological process
GO:0032501	0.381	multicellular organismal process
GO:0009892	0.337	negative regulation of metabolic process
GO:0009987	0.315	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0043232	0.718	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]