StarFunc result for job id A0A1W2PQL4

User Input

>input (384 residues)
MAERPGSPGSREMRLLTFRDIAIEFSLEEWQCLDCAQQNLYRDVMLENYRNLVSLGIADS
KPDLITCLEQNKEAWNIKRNEMVAKHPVTCSHFTQDLHPEQGIKHSLQKVIPRTYGKCGH
ENLQFKKCCKSVGECEVHKGGYNEVKQCLSNTQNKIFQTHKCVIVFGKFSNCNRHETRYT
GKKHFKCKKYGKSFCMPSHLNQHQIIHTKEKSYKCEECGKSFKRSSNCTTHKRIHTGEKP
YRCEECGKAFRWPSNLTRHKRIHTGEKPYTCEECGQAFRRSSTLTNHKRIHTGERPYKCE
ECGKAFSVSSTLNDHKRIHTGEKPYTCEECGRAFNCSSTLKTHKRIHTGEKPYKCEECDK
AFKRHSSLAKHKIIHTGEKPYKSK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IYX0	0.456	0.427	1.007E-49	411	0.839	0.783	Q8IYX0.pdb.gz	ZN679_HUMAN Zinc finger protein 679 OS=Homo sapiens OX=9606 GN=ZNF679 PE=1 SV=2
2	AFDB:Q96JC4	0.513	0.389	3.293E-49	524	0.846	0.620	Q96JC4.pdb.gz	ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens OX=9606 GN=ZNF479 PE=1 SV=1
3	AFDB:Q9H8G1	0.494	0.352	1.983E-46	570	0.695	0.468	Q9H8G1.pdb.gz	ZN430_HUMAN Zinc finger protein 430 OS=Homo sapiens OX=9606 GN=ZNF430 PE=1 SV=3
4	AFDB:Q14593	0.465	0.325	5.478E-45	569	0.677	0.457	Q14593.pdb.gz	ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens OX=9606 GN=ZNF273 PE=1 SV=3
5	AFDB:Q05481	0.460	0.173	2.141E-44	1191	0.690	0.223	Q05481.pdb.gz	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
6	AFDB:Q8IYN0	0.488	0.359	2.410E-44	542	0.674	0.478	Q8IYN0.pdb.gz	ZN100_HUMAN Zinc finger protein 100 OS=Homo sapiens OX=9606 GN=ZNF100 PE=1 SV=2
7	AFDB:Q03936	0.416	0.296	3.055E-44	586	0.698	0.457	Q03936.pdb.gz	ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens OX=9606 GN=ZNF92 PE=1 SV=2
8	AFDB:A6NNF4	0.495	0.277	1.527E-42	738	0.620	0.322	A6NNF4.pdb.gz	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
9	AFDB:Q15928	0.334	0.279	1.620E-42	474	0.589	0.477	Q15928.pdb.gz	ZN141_HUMAN Zinc finger protein 141 OS=Homo sapiens OX=9606 GN=ZNF141 PE=1 SV=1
10	AFDB:Q96H40	0.457	0.388	2.930E-42	463	0.617	0.512	Q96H40.pdb.gz	ZN486_HUMAN Zinc finger protein 486 OS=Homo sapiens OX=9606 GN=ZNF486 PE=2 SV=4
11	PDB:3w5kB	0.119	0.291	9.168E-5	110	0.102	0.355	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:6hivCv	0.080	0.041	1.007	1059	0.094	0.034	6hivCv.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
13	PDB:5dkaA	0.081	0.233	1.437	96	0.047	0.188	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
14	PDB:7uhyC	0.090	0.070	2.309	578	0.065	0.043	7uhyC.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
15	PDB:7dcoL	0.110	0.100	2.450	435	0.102	0.090	7dcoL.pdb.gz	Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.
16	PDB:6gejS	0.084	0.116	2.600	208	0.096	0.178	6gejS.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
17	PDB:7ad8D	0.051	0.063	2.759	280	0.055	0.075	7ad8D.pdb.gz	The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.
18	PDB:6n8jb	0.074	0.052	3.295	647	0.089	0.053	6n8jb.pdb.gz	Tightly-orchestrated rearrangements govern catalytic center assembly of the ribosome.
19	PDB:5wlcST	0.080	0.055	3.497	599	0.057	0.037	5wlcST.pdb.gz	The complete structure of the small-subunit processome.
20	PDB:5c8dE	0.057	0.074	3.937	280	0.023	0.032	5c8dE.pdb.gz	Structural basis for gene regulation by a B12-dependent photoreceptor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q03936	0.0	530	586	0.698	0.457	ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens OX=9606 GN=ZNF92 PE=1 SV=2
2	Q2NKJ9	0.0	520	569	0.695	0.469	Q2NKJ9_HUMAN Zinc finger protein 430 OS=Homo sapiens OX=9606 GN=ZNF430 PE=1 SV=1
3	Q8IYX0	0.0	641	411	0.823	0.769	ZN679_HUMAN Zinc finger protein 679 OS=Homo sapiens OX=9606 GN=ZNF679 PE=1 SV=2
4	Q96JC4	0.0	656	524	0.846	0.620	ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens OX=9606 GN=ZNF479 PE=1 SV=1
5	Q9H8G1	0.0	516	570	0.695	0.468	ZN430_HUMAN Zinc finger protein 430 OS=Homo sapiens OX=9606 GN=ZNF430 PE=1 SV=3
6	Q14593	1.61e-175	502	569	0.664	0.448	ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens OX=9606 GN=ZNF273 PE=1 SV=3
7	Q03923	6.34e-175	502	595	0.667	0.430	ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=3
8	Q8IYN0	6.46e-172	492	542	0.674	0.478	ZN100_HUMAN Zinc finger protein 100 OS=Homo sapiens OX=9606 GN=ZNF100 PE=1 SV=2
9	A6NNF4	2.06e-171	494	616	0.651	0.406	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
10	Q5JVG8	4.40e-170	484	444	0.635	0.550	ZN506_HUMAN Zinc finger protein 506 OS=Homo sapiens OX=9606 GN=ZNF506 PE=2 SV=2
11	O75437	6.41e-170	491	659	0.654	0.381	ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens OX=9606 GN=ZNF254 PE=2 SV=3
12	Q96H40	2.70e-169	483	463	0.641	0.531	ZN486_HUMAN Zinc finger protein 486 OS=Homo sapiens OX=9606 GN=ZNF486 PE=2 SV=4
13	Q15928	2.43e-167	478	474	0.641	0.519	ZN141_HUMAN Zinc finger protein 141 OS=Homo sapiens OX=9606 GN=ZNF141 PE=1 SV=1
14	Q8IYB9	8.97e-167	483	648	0.633	0.375	ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens OX=9606 GN=ZNF595 PE=1 SV=2
15	Q8TD23	6.76e-164	473	568	0.654	0.442	ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens OX=9606 GN=ZNF675 PE=1 SV=3
16	P35789	4.28e-162	470	620	0.630	0.390	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
17	Q05481	1.43e-161	486	1191	0.672	0.217	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
18	P17038	1.95e-158	467	809	0.635	0.302	ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens OX=9606 GN=ZNF43 PE=2 SV=4
19	Q49A12	2.14e-128	381	536	0.513	0.368	Q49A12_HUMAN ZNF85 protein OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=1
20	Q8IW36	2.86e-126	375	515	0.518	0.386	ZN695_HUMAN Zinc finger protein 695 OS=Homo sapiens OX=9606 GN=ZNF695 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10403 BHD_1	3.4	19.0	Rad4 beta-hairpin domain 1
2	PF01722 BolA	15	17.4	BolA-like protein
3	PF06397 Desulfoferrod_N	9.4e+02	10.9	Desulfoferrodoxin, N-terminal domain
4	PF12552 DUF3741	3.6	18.9	Protein of unknown function (DUF3741)
5	PF07754 HVO_2753_ZBP	2.6e+02	12.8	Small zinc finger protein HVO_2753-like, Zn-binding pocket
6	PF01352 KRAB	1.8e-20	83.5	KRAB box
7	PF01286 XPA_N	0.0098	27.2	XPA protein N-terminal
8	PF00096 zf-C2H2	4.3e-29	110.4	Zinc finger, C2H2 type
9	PF16622 zf-C2H2_11	14	16.8	zinc-finger C2H2-type
10	PF13894 zf-C2H2_4	2.1e-12	57.8	C2H2-type zinc finger
11	PF13912 zf-C2H2_6	6.4e-05	34.1	C2H2-type zinc finger
12	PF12171 zf-C2H2_jaz	1.1e-07	43.1	Zinc-finger double-stranded RNA-binding
13	PF13465 zf-H2C2_2	2.7e-51	181.0	Zinc-finger double domain
14	PF13909 zf-H2C2_5	1.1e+02	13.9	C2H2-type zinc-finger domain
15	PF02591 zf-RING_7	0.0028	29.1	C4-type zinc ribbon domain
16	PF18439 zf_UBZ	0.0038	28.2	Ubiquitin-Binding Zinc Finger
17	PF09723 Zn-ribbon_8	2.1	19.9	Zinc ribbon domain
18	PF17283 Zn_ribbon_SprT	8.2e+02	11.4	SprT-like zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003814925.2

Rank	PPI partner	STRING score	Description
1	9597.XP_008958403.1	0.509	Belongs to the histone H2B family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.997	protein binding
GO:0003677	0.566	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.989	regulation of biological process
GO:0080090	0.979	regulation of primary metabolic process
GO:0050794	0.954	regulation of cellular process
GO:0010605	0.945	negative regulation of macromolecule metabolic process
GO:0048523	0.940	negative regulation of cellular process
GO:0009889	0.938	regulation of biosynthetic process
GO:0051172	0.930	negative regulation of nitrogen compound metabolic process
GO:0010556	0.929	regulation of macromolecule biosynthetic process
GO:0031326	0.929	regulation of cellular biosynthetic process
GO:0031324	0.929	negative regulation of cellular metabolic process
GO:0010468	0.924	regulation of gene expression
GO:0010558	0.924	negative regulation of macromolecule biosynthetic process
GO:2001141	0.922	regulation of RNA biosynthetic process
GO:0031327	0.908	negative regulation of cellular biosynthetic process
GO:1903506	0.894	regulation of nucleic acid-templated transcription
GO:0051253	0.810	negative regulation of RNA metabolic process
GO:0006355	0.786	regulation of DNA-templated transcription
GO:1902679	0.699	negative regulation of RNA biosynthetic process
GO:0045892	0.650	negative regulation of DNA-templated transcription
GO:0009987	0.518	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.998	nucleus
GO:0070013	0.877	intracellular organelle lumen
GO:0005654	0.796	nucleoplasm
GO:0005576	0.612	extracellular region
GO:0031982	0.585	vesicle
GO:0005737	0.330	cytoplasm
GO:0070062	0.330	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]