StarFunc result for job id A0A1W2PR95

User Input

>input (340 residues)
MAAAEDEFLPPPRLPELFDSSKQLLDEVEGATEPTGSRIVQEKVFKGLDLLDKVAKMLSQ
LDLFSRNEDLEEITSTDLKYLMVPAFQGALTMKQVNPRKRLDHLQQAREHFIKYLTQCHY
YRVAEFELPQTKTNSAENHGAITSTAYPSLVAMASQRQAKIERYKQKKVLEHKLSTMKSA
VESGQADNERVREYYLLHLQRWIDISLEEIESIDQEIKILGEKDSSREASTSNSCHQKRP
PMKPFILTRNMAQAKVFGAGYPSLASMTVSDWYDQHQKHGVLPDQGIAKATPEEFRKATQ
QQEDQEKEEEDDEQTLQRAREWDDWKDTHPRGYGNRQNMG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P78318	0.653	0.655	2.574E-36	339	0.856	0.858	P78318.pdb.gz	IGBP1_HUMAN Immunoglobulin-binding protein 1 OS=Homo sapiens OX=9606 GN=IGBP1 PE=1 SV=1
2	AFDB:O08836	0.631	0.631	5.202E-33	340	0.771	0.771	O08836.pdb.gz	IGBP1_RAT Immunoglobulin-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Igbp1 PE=2 SV=2
3	AFDB:Q9QZ29	0.647	0.642	1.938E-26	343	0.618	0.612	Q9QZ29.pdb.gz	IGB1B_MOUSE Immunoglobulin-binding protein 1b OS=Mus musculus OX=10090 GN=Igbp1b PE=1 SV=1
4	AFDB:Q9N4E9	0.584	0.605	6.265E-15	327	0.306	0.318	Q9N4E9.pdb.gz	PP4RS_CAEEL Serine/threonine-protein phosphatase 4 regulatory subunit ppfr-4 OS=Caenorhabditis elegans OX=6239 GN=ppfr-4 PE=1 SV=1
5	AFDB:Q9VJZ5	0.554	0.501	1.037E-14	380	0.288	0.258	Q9VJZ5.pdb.gz	Q9VJZ5_DROME LD07294p OS=Drosophila melanogaster OX=7227 GN=Tap42 PE=1 SV=2
6	AFDB:Q9Y7T1	0.490	0.515	1.467E-12	323	0.244	0.257	Q9Y7T1.pdb.gz	YCJ5_SCHPO Uncharacterized protein C63.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC63.05 PE=3 SV=1
7	AFDB:D2K8N5	0.468	0.396	4.785E-11	403	0.244	0.206	D2K8N5.pdb.gz	TAP46_NICBE PP2A regulatory subunit TAP46 OS=Nicotiana benthamiana OX=4100 GN=TAP46 PE=1 SV=1
8	AFDB:Q04372	0.538	0.502	6.596E-11	366	0.232	0.216	Q04372.pdb.gz	TAP42_YEAST Type 2A phosphatase-associated protein 42 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TAP42 PE=1 SV=1
9	AFDB:Q8LDQ4	0.481	0.406	3.767E-10	405	0.241	0.202	Q8LDQ4.pdb.gz	TAP46_ARATH PP2A regulatory subunit TAP46 OS=Arabidopsis thaliana OX=3702 GN=TAP46 PE=1 SV=2
10	AFDB:Q57XV0	0.460	0.398	1.273E-7	397	0.176	0.151	Q57XV0.pdb.gz	Q57XV0_TRYB2 TAP42-like protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.1J15.790 PE=4 SV=1
11	PDB:7sicA	0.152	0.029	4.579E-1	2773	0.100	0.012	7sicA.pdb.gz	Structure of the human ATM kinase and mechanism of Nbs1 binding.
12	PDB:7z0lB	0.116	0.109	5.019E-1	370	0.062	0.057	7z0lB.pdb.gz
13	PDB:4f7rD	0.134	0.183	6.312E-1	238	0.035	0.050	4f7rD.pdb.gz
14	PDB:1t72A	0.150	0.212	7.939E-1	215	0.082	0.130	1t72A.pdb.gz
15	PDB:6gn0A	0.189	0.253	7.939E-1	239	0.041	0.059	6gn0A.pdb.gz
16	PDB:7l08AL	0.113	0.178	7.939E-1	174	0.062	0.121	7l08AL.pdb.gz	Distinct mechanisms of the human mitoribosome recycling and antibiotic resistance.
17	PDB:4cniC	0.103	0.168	8.311E-1	171	0.076	0.152	4cniC.pdb.gz
18	PDB:2kmfA	0.167	0.394	9.537E-1	115	0.032	0.096	2kmfA.pdb.gz
19	PDB:3zc0B	0.171	0.271	9.537E-1	191	0.068	0.120	3zc0B.pdb.gz	Structural Basis for Duplex RNA Recognition and Cleavage by Archaeoglobus Fulgidus C3Po.
20	PDB:4cguA	0.160	0.415	1.045	112	0.029	0.089	4cguA.pdb.gz	Structural Basis for Phosphorylation-Dependent Recruitment of Tel2 to Hsp90 by Pih1.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P78318	0.0	561	339	0.847	0.850	IGBP1_HUMAN Immunoglobulin-binding protein 1 OS=Homo sapiens OX=9606 GN=IGBP1 PE=1 SV=1
2	Q61249	2.39e-179	501	340	0.721	0.721	IGBP1_MOUSE Immunoglobulin-binding protein 1 OS=Mus musculus OX=10090 GN=Igbp1 PE=1 SV=1
3	O08836	3.38e-178	498	340	0.724	0.724	IGBP1_RAT Immunoglobulin-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Igbp1 PE=2 SV=2
4	Q9QZ29	3.81e-138	397	343	0.615	0.609	IGB1B_MOUSE Immunoglobulin-binding protein 1b OS=Mus musculus OX=10090 GN=Igbp1b PE=1 SV=1
5	Q9N4E9	3.61e-40	145	327	0.300	0.312	PP4RS_CAEEL Serine/threonine-protein phosphatase 4 regulatory subunit ppfr-4 OS=Caenorhabditis elegans OX=6239 GN=ppfr-4 PE=1 SV=1
6	Q9VJZ5	1.02e-37	140	380	0.303	0.271	Q9VJZ5_DROME LD07294p OS=Drosophila melanogaster OX=7227 GN=Tap42 PE=1 SV=2
7	Q9Y7T1	1.21e-19	90.1	323	0.276	0.291	YCJ5_SCHPO Uncharacterized protein C63.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC63.05 PE=3 SV=1
8	Q04372	1.67e-14	75.9	366	0.262	0.243	TAP42_YEAST Type 2A phosphatase-associated protein 42 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TAP42 PE=1 SV=1
9	Q8LDQ4	7.56e-12	68.2	405	0.282	0.237	TAP46_ARATH PP2A regulatory subunit TAP46 OS=Arabidopsis thaliana OX=3702 GN=TAP46 PE=1 SV=2
10	D2K8N5	1.08e-10	64.7	403	0.132	0.112	TAP46_NICBE PP2A regulatory subunit TAP46 OS=Nicotiana benthamiana OX=4100 GN=TAP46 PE=1 SV=1
11	O14116	0.92	33.9	1234	0.065	0.018	YKX1_SCHPO Uncharacterized protein C328.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC328.01c PE=4 SV=2
12	Q57XM6	4.5	31.6	383	0.044	0.039	Q57XM6_TRYB2 Peptidyl-prolyl cis-trans isomerase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.22O10.530 PE=1 SV=1
13	Q8L7C9	4.7	31.2	217	0.076	0.120	GSTUK_ARATH Glutathione S-transferase U20 OS=Arabidopsis thaliana OX=3702 GN=GSTU20 PE=1 SV=1
14	P43165	4.9	31.2	304	0.079	0.089	CAH5A_RAT Carbonic anhydrase 5A, mitochondrial OS=Rattus norvegicus OX=10116 GN=Ca5a PE=1 SV=1
15	Q55FB8	5.7	31.6	1272	0.074	0.020	PSLA_DICDI Presporeless protein A OS=Dictyostelium discoideum OX=44689 GN=pslA PE=1 SV=1
16	P23589	5.8	31.2	299	0.071	0.080	CAH5A_MOUSE Carbonic anhydrase 5A, mitochondrial OS=Mus musculus OX=10090 GN=Ca5a PE=1 SV=2
17	Q60803	6.0	31.2	567	0.053	0.032	TRAF3_MOUSE TNF receptor-associated factor 3 OS=Mus musculus OX=10090 GN=Traf3 PE=1 SV=2
18	Q13114	6.1	31.2	568	0.053	0.032	TRAF3_HUMAN TNF receptor-associated factor 3 OS=Homo sapiens OX=9606 GN=TRAF3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04177 TAP42	2.6e-80	281.8	TAP42-like family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000028658

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000000333	0.918	Protein phosphatase 2, catalytic subunit, alpha isozyme
2	9593.ENSGGOP00000013634	0.888	Protein phosphatase 2, catalytic subunit, beta isozyme
3	9593.ENSGGOP00000024849	0.875	Protein phosphatase 6, catalytic subunit
4	9593.ENSGGOP00000008443	0.872	Protein phosphatase 4, catalytic subunit
5	9593.ENSGGOP00000003692	0.808	Midline 1
6	9593.ENSGGOP00000024412	0.795	TOR signaling pathway regulator
7	9593.ENSGGOP00000017833	0.690	Serine/threonine-protein kinase mTOR
8	9593.ENSGGOP00000022421	0.676	Bardet-Biedl syndrome 10
9	9593.ENSGGOP00000013216	0.583	Midline 2
10	9593.ENSGGOP00000007603	0.569	Chaperonin containing TCP1 subunit 7
11	9593.ENSGGOP00000019195	0.569	Uncharacterized protein
12	9593.ENSGGOP00000020185	0.541	Protein phosphatase 4 regulatory subunit 3A
13	9593.ENSGGOP00000016913	0.533	Protein phosphatase 2, regulatory subunit B, alpha
14	9593.ENSGGOP00000000353	0.527	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit
15	9593.ENSGGOP00000008750	0.524	Protein phosphatase 4, regulatory subunit 4
16	9593.ENSGGOP00000014629	0.524	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit
17	9593.ENSGGOP00000008215	0.517	Protein phosphatase 4, regulatory subunit 2
18	9593.ENSGGOP00000019622	0.517	Uncharacterized protein
19	9593.ENSGGOP00000028183	0.517	Uncharacterized protein
20	9593.ENSGGOP00000003636	0.501	Ribosomal protein L4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030234	0.997	enzyme regulator activity
GO:0019899	0.997	enzyme binding
GO:0019208	0.988	phosphatase regulator activity
GO:0019888	0.731	protein phosphatase regulator activity
GO:0019900	0.660	kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0031323	0.986	regulation of cellular metabolic process
GO:0060255	0.985	regulation of macromolecule metabolic process
GO:0048519	0.970	negative regulation of biological process
GO:0051171	0.942	regulation of nitrogen compound metabolic process
GO:0080090	0.940	regulation of primary metabolic process
GO:0009966	0.895	regulation of signal transduction
GO:0009889	0.883	regulation of biosynthetic process
GO:0009987	0.877	cellular process
GO:0048523	0.865	negative regulation of cellular process
GO:0050896	0.785	response to stimulus
GO:0009892	0.782	negative regulation of metabolic process
GO:0051246	0.744	regulation of protein metabolic process
GO:0031326	0.694	regulation of cellular biosynthetic process
GO:0010556	0.605	regulation of macromolecule biosynthetic process
GO:0019219	0.601	regulation of nucleobase-containing compound metabolic process
GO:0010941	0.553	regulation of cell death
GO:0048518	0.542	positive regulation of biological process
GO:0048585	0.539	negative regulation of response to stimulus
GO:0010468	0.506	regulation of gene expression
GO:0048522	0.488	positive regulation of cellular process
GO:0051252	0.388	regulation of RNA metabolic process
GO:0043067	0.366	regulation of programmed cell death
GO:0023057	0.361	negative regulation of signaling
GO:0010648	0.361	negative regulation of cell communication
GO:0060548	0.357	negative regulation of cell death
GO:0043069	0.354	negative regulation of programmed cell death
GO:2001141	0.338	regulation of RNA biosynthetic process
GO:1903506	0.320	regulation of nucleic acid-templated transcription
GO:0042981	0.316	regulation of apoptotic process
GO:0006355	0.313	regulation of DNA-templated transcription
GO:0031324	0.307	negative regulation of cellular metabolic process
GO:0051248	0.303	negative regulation of protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043232	0.996	intracellular non-membrane-bounded organelle
GO:0032991	0.914	protein-containing complex
GO:0005856	0.912	cytoskeleton
GO:0099080	0.840	supramolecular complex
GO:0005829	0.784	cytosol
GO:0099081	0.774	supramolecular polymer
GO:0015630	0.749	microtubule cytoskeleton
GO:0099512	0.737	supramolecular fiber
GO:0043231	0.703	intracellular membrane-bounded organelle
GO:0099513	0.681	polymeric cytoskeletal fiber
GO:0005874	0.507	microtubule

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]