StarFunc result for job id A0A1W2PRN6

User Input

>input (198 residues)
METGRQAGVSAEMFAMPRGLKGSNKDGIPEDLDGNLEEPRDQEGELRSQDVMDLTEGDKE
TSASAPPAAKRLKTDTKGKKERKPTVDAEEAQRMTTLLSAMSEEQLARYEVCRQSAFPKA
RIAALMQSITGSSVSENVAIAMAGIAKVLVGEVVEEALDVCEMWGEMPPLQPKHLREAVR
RLKPKGLFPNSNYKKFMF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15544	0.545	0.513	2.516E-16	211	0.616	0.578	Q15544.pdb.gz	TAF11_HUMAN Transcription initiation factor TFIID subunit 11 OS=Homo sapiens OX=9606 GN=TAF11 PE=1 SV=1
2	AFDB:Q99JX1	0.583	0.552	5.663E-16	211	0.586	0.550	Q99JX1.pdb.gz	TAF11_MOUSE Transcription initiation factor TFIID subunit 11 OS=Mus musculus OX=10090 GN=Taf11 PE=1 SV=1
3	AFDB:P49906	0.547	0.553	9.526E-13	196	0.409	0.413	P49906.pdb.gz	TAF11_DROME Transcription initiation factor TFIID subunit 11 OS=Drosophila melanogaster OX=7227 GN=Taf11 PE=1 SV=1
4	AFDB:A0A3B3ITY8	0.346	0.343	2.298E-11	200	0.475	0.470	A0A3B3ITY8.pdb.gz	A0A3B3ITY8_HUMAN TATA-box binding protein associated factor 11 OS=Homo sapiens OX=9606 GN=TAF11 PE=1 SV=1
5	AFDB:Q9US54	0.495	0.493	9.074E-11	199	0.293	0.291	Q9US54.pdb.gz	TAF11_SCHPO Transcription initiation factor TFIID subunit 11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=taf11 PE=3 SV=1
6	PDB:7edxk	0.455	0.887	1.196E-10	98	0.374	0.755	7edxk.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
7	AFDB:Q9M565	0.521	0.493	8.643E-9	210	0.288	0.271	Q9M565.pdb.gz	TAF11_ARATH Transcription initiation factor TFIID subunit 11 OS=Arabidopsis thaliana OX=3702 GN=TAF11 PE=1 SV=1
8	PDB:1bfmA	0.324	0.860	5.974E-3	69	0.076	0.217	1bfmA.pdb.gz
9	PDB:5z30G	0.300	0.509	1.048E-2	110	0.116	0.209	5z30G.pdb.gz	Cancer-associated mutations of histones H2B, H3.1 and H2A.Z.1 affect the structure and stability of the nucleosome.
10	PDB:2rvqD	0.316	0.467	2.082E-2	129	0.091	0.140	2rvqD.pdb.gz
11	PDB:4draH	0.322	0.760	2.216E-2	76	0.066	0.171	4draH.pdb.gz
12	PDB:1b67A	0.319	0.881	2.672E-2	68	0.071	0.206	1b67A.pdb.gz
13	PDB:1jfiB	0.331	0.475	2.844E-2	135	0.056	0.081	1jfiB.pdb.gz	Crystal structure of negative cofactor 2 recognizing the TBP-DNA transcription complex.
14	PDB:7egdF	0.326	0.159	3.430E-2	412	0.045	0.022	7egdF.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
15	PDB:5y27A	0.336	0.646	4.686E-2	98	0.071	0.143	5y27A.pdb.gz
16	AFDB:Q12962	0.299	0.274	4.859E-2	218	0.152	0.138	Q12962.pdb.gz	TAF10_HUMAN Transcription initiation factor TFIID subunit 10 OS=Homo sapiens OX=9606 GN=TAF10 PE=1 SV=1
17	PDB:3b0bC	0.320	0.766	4.988E-2	75	0.066	0.173	3b0bC.pdb.gz
18	AFDB:Q9U226	0.326	0.194	5.505E-2	342	0.141	0.082	Q9U226.pdb.gz	TAF12_CAEEL Transcription initiation factor TFIID subunit 12 OS=Caenorhabditis elegans OX=6239 GN=taf-12 PE=1 SV=2
19	AFDB:Q8IHQ2	0.353	0.064	1.094E-1	1301	0.141	0.022	Q8IHQ2.pdb.gz	Q8IHQ2_PLAF7 Oocyst rupture protein 1, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1146600 PE=3 SV=1
20	AFDB:Q9W3V9	0.322	0.113	1.802E-1	601	0.177	0.058	Q9W3V9.pdb.gz	Q9W3V9_DROME Nuclear factor Y-box C OS=Drosophila melanogaster OX=7227 GN=Nf-YC PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q15544	4.00e-70	214	211	0.616	0.578	TAF11_HUMAN Transcription initiation factor TFIID subunit 11 OS=Homo sapiens OX=9606 GN=TAF11 PE=1 SV=1
2	Q99JX1	1.39e-65	202	211	0.596	0.559	TAF11_MOUSE Transcription initiation factor TFIID subunit 11 OS=Mus musculus OX=10090 GN=Taf11 PE=1 SV=1
3	A0A3B3ITY8	1.07e-40	139	200	0.455	0.450	A0A3B3ITY8_HUMAN TATA-box binding protein associated factor 11 OS=Homo sapiens OX=9606 GN=TAF11 PE=1 SV=1
4	P49906	4.35e-37	129	196	0.328	0.332	TAF11_DROME Transcription initiation factor TFIID subunit 11 OS=Drosophila melanogaster OX=7227 GN=Taf11 PE=1 SV=1
5	Q9US54	2.55e-23	94.0	199	0.288	0.286	TAF11_SCHPO Transcription initiation factor TFIID subunit 11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=taf11 PE=3 SV=1
6	Q9M565	2.42e-15	73.2	210	0.207	0.195	TAF11_ARATH Transcription initiation factor TFIID subunit 11 OS=Arabidopsis thaliana OX=3702 GN=TAF11 PE=1 SV=1
7	Q04226	8.84e-07	50.4	346	0.086	0.049	TAF11_YEAST Transcription initiation factor TFIID subunit 11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TAF11 PE=1 SV=1
8	Q86XD5	4.2	30.4	332	0.051	0.030	F131B_HUMAN Protein FAM131B OS=Homo sapiens OX=9606 GN=FAM131B PE=1 SV=3
9	Q9ERA7	6.5	30.0	625	0.141	0.045	MSLN_RAT Mesothelin OS=Rattus norvegicus OX=10116 GN=Msln PE=2 SV=2
10	E9PZ22	8.6	29.6	914	0.086	0.019	E9PZ22_MOUSE Maestro heat-like repeat family member 4 OS=Mus musculus OX=10090 GN=Mroh4 PE=1 SV=1
11	Q14DS2	8.6	29.6	914	0.086	0.019	Q14DS2_MOUSE 1700016M24Rik protein OS=Mus musculus OX=10090 GN=Mroh4 PE=2 SV=1
12	Q9DA96	9.5	29.6	983	0.086	0.017	Q9DA96_MOUSE Maestro heat-like repeat family member 5 OS=Mus musculus OX=10090 GN=Mroh4 PE=2 SV=1
13	G3X8W1	9.6	29.6	983	0.086	0.017	G3X8W1_MOUSE Maestro heat-like repeat family member 4 OS=Mus musculus OX=10090 GN=Mroh4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00808 CBFD_NFYB_HMF	4.5	18.9	Histone-like transcription factor (CBF/NF-Y) and archaeal histone
2	PF07892 DUF1667	2.1e+02	13.4	Protein of unknown function (DUF1667)
3	PF14695 LINES_C	1.7e+02	13.0	Lines C-terminus
4	PF15341 SLX9	51	15.6	Ribosome biogenesis protein SLX9
5	PF04719 TAFII28	1.7e-27	106.7	hTAFII28-like protein conserved region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000020068

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000002710	0.924	TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa
2	9593.ENSGGOP00000007336	0.924	TAF2 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 150kDa
3	9593.ENSGGOP00000000388	0.921	Transcription initiation factor TFIID subunit 10
4	9593.ENSGGOP00000008371	0.914	TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa
5	9593.ENSGGOP00000008899	0.913	TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa
6	9593.ENSGGOP00000005330	0.889	TAF5 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 100kDa
7	9593.ENSGGOP00000027533	0.888	TAF8 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 43kDa
8	9593.ENSGGOP00000016296	0.883	TAF3 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 140kDa
9	9593.ENSGGOP00000002080	0.859	Uncharacterized protein
10	9593.ENSGGOP00000003902	0.859	TAF4b RNA polymerase II, TATA box binding protein (TBP)-associated factor, 105kDa
11	9593.ENSGGOP00000009307	0.855	Uncharacterized protein
12	9593.ENSGGOP00000023578	0.855	Uncharacterized protein
13	9593.ENSGGOP00000001038	0.851	TATA box binding protein like 2
14	9593.ENSGGOP00000002430	0.851	TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa
15	9593.ENSGGOP00000004050	0.851	TATA-box binding protein associated factor 9
16	9593.ENSGGOP00000011550	0.851	TATA box binding protein
17	9593.ENSGGOP00000015303	0.851	Transcription initiation factor TFIID subunit
18	9593.ENSGGOP00000026097	0.851	Transcription initiation factor TFIID subunit
19	9593.ENSGGOP00000018571	0.846	TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa
20	9593.ENSGGOP00000011524	0.836	TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016251	0.970	RNA polymerase II general transcription initiation factor activity
GO:0008134	0.875	transcription factor binding
GO:0003677	0.749	DNA binding
GO:0061629	0.511	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0016922	0.343	nuclear receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.988	regulation of biological process
GO:0048518	0.969	positive regulation of biological process
GO:0010468	0.965	regulation of gene expression
GO:0009987	0.963	cellular process
GO:0050794	0.941	regulation of cellular process
GO:0071704	0.927	organic substance metabolic process
GO:0044237	0.927	cellular metabolic process
GO:0044238	0.926	primary metabolic process
GO:0006807	0.914	nitrogen compound metabolic process
GO:1901576	0.899	organic substance biosynthetic process
GO:0044249	0.899	cellular biosynthetic process
GO:0043170	0.897	macromolecule metabolic process
GO:0009059	0.890	macromolecule biosynthetic process
GO:0034654	0.886	nucleobase-containing compound biosynthetic process
GO:0097659	0.865	nucleic acid-templated transcription
GO:0006351	0.853	DNA-templated transcription
GO:0006366	0.818	transcription by RNA polymerase II
GO:0031323	0.790	regulation of cellular metabolic process
GO:0009893	0.774	positive regulation of metabolic process
GO:0048522	0.771	positive regulation of cellular process
GO:0071840	0.762	cellular component organization or biogenesis
GO:0010604	0.758	positive regulation of macromolecule metabolic process
GO:0019219	0.715	regulation of nucleobase-containing compound metabolic process
GO:0016043	0.697	cellular component organization
GO:0051252	0.697	regulation of RNA metabolic process
GO:0006367	0.650	transcription initiation at RNA polymerase II promoter
GO:0009889	0.606	regulation of biosynthetic process
GO:0010556	0.573	regulation of macromolecule biosynthetic process
GO:0031326	0.573	regulation of cellular biosynthetic process
GO:2001141	0.560	regulation of RNA biosynthetic process
GO:0045935	0.540	positive regulation of nucleobase-containing compound metabolic process
GO:0051254	0.534	positive regulation of RNA metabolic process
GO:0006355	0.528	regulation of DNA-templated transcription
GO:1903508	0.435	positive regulation of nucleic acid-templated transcription
GO:0045893	0.430	positive regulation of DNA-templated transcription
GO:0006357	0.402	regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.995	nucleus
GO:0005654	0.988	nucleoplasm
GO:0032991	0.966	protein-containing complex
GO:0005737	0.920	cytoplasm
GO:0005667	0.841	transcription regulator complex
GO:1902494	0.716	catalytic complex
GO:1990234	0.690	transferase complex
GO:0061695	0.615	transferase complex, transferring phosphorus-containing groups
GO:0055029	0.606	nuclear DNA-directed RNA polymerase complex
GO:0016591	0.551	RNA polymerase II, holoenzyme

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]