StarFunc result for job id A0A1W2PRP0

User Input

>input (233 residues)
MFDSSQYPYNCFNYDADDYPAGSSDEDKRLTRPAYSYIALIAMAIQQSPAGRVTLSGIYD
FIMRKFPYYRANQRAWQNSIRHNLSLNSCFVKVPRSEGHEKGKGNYWTFAGGCESLLDLF
ENGNYRRRRRRRGPKREGPRGPRAGGAQGPSGPSEPPAAQGRLAPDSAGEGAPGREPPAS
PAPPGKEHPRDLKFSIDYILSSPDPFPGLKPPCLAQEGRYPRLENVGLHFWTM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1QJW8	0.426	0.351	1.673E-15	285	0.352	0.288	F1QJW8.pdb.gz	F1QJW8_DANRE Forkhead box protein L2 OS=Danio rerio OX=7955 GN=foxl2-like PE=2 SV=2
2	AFDB:Q1JPV2	0.416	0.320	3.087E-15	306	0.386	0.294	Q1JPV2.pdb.gz	Q1JPV2_DANRE Forkhead box protein L2 OS=Danio rerio OX=7955 GN=foxl2-1 PE=2 SV=1
3	AFDB:Q91905	0.444	0.289	1.050E-14	367	0.335	0.213	Q91905.pdb.gz	FXI1B_XENLA Forkhead box protein I1-B OS=Xenopus laevis OX=8355 GN=foxi1-b PE=2 SV=1
4	AFDB:Q7ZYQ0	0.443	0.281	1.714E-14	373	0.369	0.231	Q7ZYQ0.pdb.gz	FXI1E_XENLA Forkhead box protein I1-ema OS=Xenopus laevis OX=8355 GN=foxi1e PE=2 SV=1
5	AFDB:Q64731	0.419	0.295	1.822E-14	336	0.421	0.292	Q64731.pdb.gz	FOXL1_MOUSE Forkhead box protein L1 OS=Mus musculus OX=10090 GN=Foxl1 PE=2 SV=2
6	AFDB:E0XEN6	0.449	0.281	3.162E-14	378	0.352	0.217	E0XEN6.pdb.gz	E0XEN6_HUMAN Forkhead box I1 OS=Homo sapiens OX=9606 GN=FOXI1 PE=4 SV=1
7	AFDB:Q12952	0.406	0.278	3.574E-14	345	0.446	0.301	Q12952.pdb.gz	FOXL1_HUMAN Forkhead box protein L1 OS=Homo sapiens OX=9606 GN=FOXL1 PE=2 SV=2
8	AFDB:Q8MIP2	0.426	0.269	4.039E-14	377	0.386	0.239	Q8MIP2.pdb.gz	FOXL2_CAPHI Forkhead box protein L2 OS=Capra hircus OX=9925 GN=FOXL2 PE=1 SV=1
9	AFDB:Q91904	0.443	0.286	4.039E-14	370	0.326	0.205	Q91904.pdb.gz	FXI1A_XENLA Forkhead box protein I1-A OS=Xenopus laevis OX=8355 GN=foxi1-a PE=1 SV=1
10	AFDB:A3KNJ3	0.439	0.294	5.160E-14	353	0.339	0.224	A3KNJ3.pdb.gz	FXI3A_DANRE Forkhead box protein I3-A OS=Danio rerio OX=7955 GN=foxi3a PE=2 SV=1
11	PDB:2hdcA	0.320	0.650	7.248E-8	97	0.262	0.629	2hdcA.pdb.gz	Dynamic DNA contacts observed in the NMR structure of winged helix protein-DNA complex.
12	PDB:5k1yD	0.189	0.383	5.454E-2	92	0.112	0.283	5k1yD.pdb.gz	Detailed structural analysis of AspA-DNA contacts
13	PDB:2qbyA	0.248	0.171	5.798E-2	366	0.077	0.049	2qbyA.pdb.gz	Replication origin recognition and deformation by a heterodimeric archaeal Orc1 complex.
14	PDB:2fxaB	0.242	0.300	6.967E-2	180	0.056	0.072	2fxaB.pdb.gz
15	PDB:6jmiA	0.234	0.467	6.967E-2	100	0.052	0.120	6jmiA.pdb.gz
16	PDB:3euhB	0.285	0.215	7.407E-2	321	0.052	0.037	3euhB.pdb.gz
17	PDB:2fe3B	0.231	0.348	1.006E-1	143	0.043	0.070	2fe3B.pdb.gz	Crystal structure of the apo-PerR-Zn protein from Bacillus subtilis.
18	PDB:2nyxB	0.263	0.389	1.006E-1	147	0.034	0.054	2nyxB.pdb.gz
19	PDB:2qbyB	0.260	0.177	1.366E-1	368	0.073	0.046	2qbyB.pdb.gz	Replication origin recognition and deformation by a heterodimeric archaeal Orc1 complex.
20	PDB:6l9zS	0.238	0.545	1.642E-1	84	0.060	0.167	6l9zS.pdb.gz	Engineering nucleosomes for generating diverse chromatin assemblies.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7SY22	7.68e-41	145	363	0.369	0.237	Q7SY22_DANRE Forkhead box L1 OS=Danio rerio OX=7955 GN=zgc:63595 PE=2 SV=1
2	Q64731	1.47e-40	143	336	0.300	0.208	FOXL1_MOUSE Forkhead box protein L1 OS=Mus musculus OX=10090 GN=Foxl1 PE=2 SV=2
3	Q12952	4.46e-40	142	345	0.309	0.209	FOXL1_HUMAN Forkhead box protein L1 OS=Homo sapiens OX=9606 GN=FOXL1 PE=2 SV=2
4	Q91905	1.48e-36	134	367	0.305	0.193	FXI1B_XENLA Forkhead box protein I1-B OS=Xenopus laevis OX=8355 GN=foxi1-b PE=2 SV=1
5	E0XEN6	2.77e-35	130	378	0.266	0.164	E0XEN6_HUMAN Forkhead box I1 OS=Homo sapiens OX=9606 GN=FOXI1 PE=4 SV=1
6	Q12951	2.77e-35	130	378	0.266	0.164	FOXI1_HUMAN Forkhead box protein I1 OS=Homo sapiens OX=9606 GN=FOXI1 PE=1 SV=3
7	P35583	2.81e-35	132	459	0.361	0.183	FOXA2_MOUSE Hepatocyte nuclear factor 3-beta OS=Mus musculus OX=10090 GN=Foxa2 PE=1 SV=2
8	Q7ZYQ0	4.96e-35	130	373	0.266	0.166	FXI1E_XENLA Forkhead box protein I1-ema OS=Xenopus laevis OX=8355 GN=foxi1e PE=2 SV=1
9	Q1JPV2	5.43e-35	128	306	0.258	0.196	Q1JPV2_DANRE Forkhead box protein L2 OS=Danio rerio OX=7955 GN=foxl2-1 PE=2 SV=1
10	F1QJW8	6.59e-35	127	285	0.253	0.207	F1QJW8_DANRE Forkhead box protein L2 OS=Danio rerio OX=7955 GN=foxl2-like PE=2 SV=2
11	Q91904	9.57e-35	129	370	0.288	0.181	FXI1A_XENLA Forkhead box protein I1-A OS=Xenopus laevis OX=8355 GN=foxi1-a PE=1 SV=1
12	Q7T1C0	1.59e-34	129	383	0.279	0.170	FXI3B_DANRE Forkhead box protein I3-B OS=Danio rerio OX=7955 GN=foxi3b PE=2 SV=1
13	A3KNJ3	3.01e-34	127	353	0.253	0.167	FXI3A_DANRE Forkhead box protein I3-A OS=Danio rerio OX=7955 GN=foxi3a PE=2 SV=1
14	O88470	7.61e-34	127	375	0.253	0.157	FOXL2_MOUSE Forkhead box protein L2 OS=Mus musculus OX=10090 GN=Foxl2 PE=1 SV=2
15	Q2TVT7	7.61e-34	127	375	0.253	0.157	Q2TVT7_MOUSE Forkhead box protein L2 OS=Mus musculus OX=10090 GN=Foxl2 PE=2 SV=1
16	D4A0S1	8.84e-34	126	374	0.253	0.158	D4A0S1_RAT Forkhead box protein L2 OS=Rattus norvegicus OX=10116 GN=Foxl2 PE=4 SV=1
17	P58012	1.03e-33	126	376	0.253	0.157	FOXL2_HUMAN Forkhead box protein L2 OS=Homo sapiens OX=9606 GN=FOXL2 PE=1 SV=1
18	Q53ZD3	1.03e-33	126	376	0.253	0.157	Q53ZD3_HUMAN Forkhead box protein L2 OS=Homo sapiens OX=9606 GN=FOXL2 PE=4 SV=1
19	Q8MIP2	1.26e-33	126	377	0.253	0.156	FOXL2_CAPHI Forkhead box protein L2 OS=Capra hircus OX=9925 GN=FOXL2 PE=1 SV=1
20	O43638	7.30e-33	123	330	0.296	0.209	FOXS1_HUMAN Forkhead box protein S1 OS=Homo sapiens OX=9606 GN=FOXS1 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00250 Forkhead	9.6e-32	120.3	Forkhead domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 27679.XP_003943810.1

Rank	PPI partner	STRING score	Description
1	27679.XP_003929503.1	0.594	Pituitary homeobox 2 isoform X3
2	27679.XP_003932628.1	0.549	Nuclear factor of activated T-cells, cytoplasmic 2 isoform X1
3	27679.XP_003933397.1	0.528	Belongs to the protein kinase superfamily.
4	27679.XP_003935379.1	0.528	Belongs to the protein kinase superfamily.
5	27679.XP_003943209.1	0.528	Belongs to the protein kinase superfamily.
6	27679.XP_003927384.1	0.514	NAD-dependent lysine demalonylase, desuccinylase and deglutarylase that specifically removes malonyl, succinyl and glutaryl groups on target proteins. Activates CPS1 and contributes to the regulation of blood ammonia levels during prolonged fasting: acts by mediating desuccinylation and deglutarylation of CPS1, thereby increasing CPS1 activity in response to elevated NAD levels during fasting. Activates SOD1 by mediating its desuccinylation, leading to reduced reactive oxygen species. Modulates ketogenesis through the desuccinylation and activation of HMGCS2. Has weak NAD-dependent pro [...]
7	27679.XP_003928730.1	0.514	NAD-dependent protein deacetylase sirtuin-1 isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0043565	1.000	sequence-specific DNA binding
GO:0003700	0.996	DNA-binding transcription factor activity
GO:0000976	0.986	transcription cis-regulatory region binding
GO:0005515	0.970	protein binding
GO:0000981	0.861	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.745	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.696	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.452	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.949	biological regulation
GO:0032502	0.946	developmental process
GO:0050794	0.935	regulation of cellular process
GO:0048856	0.933	anatomical structure development
GO:0009987	0.705	cellular process
GO:0048513	0.667	animal organ development
GO:0019222	0.626	regulation of metabolic process
GO:0032501	0.621	multicellular organismal process
GO:0060255	0.601	regulation of macromolecule metabolic process
GO:0010468	0.594	regulation of gene expression
GO:0080090	0.518	regulation of primary metabolic process
GO:0031326	0.518	regulation of cellular biosynthetic process
GO:0051171	0.516	regulation of nitrogen compound metabolic process
GO:0006355	0.498	regulation of DNA-templated transcription
GO:0007275	0.486	multicellular organism development
GO:0050896	0.430	response to stimulus
GO:0048519	0.345	negative regulation of biological process
GO:0048731	0.329	system development
GO:0048523	0.329	negative regulation of cellular process
GO:0071704	0.327	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0031981	0.681	nuclear lumen
GO:0005654	0.404	nucleoplasm
GO:0032991	0.375	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]