StarFunc result for job id A0A1W2PS18

User Input

>input (150 residues)
MALKPPSATQPAPNAPATPDAPPTTGDPGASAAPGSPTTTGGPGAPAEVPQEPQEPTQTP
EELAFYAPNYLCLTIFAILLFPPFGLAALYFSYEGSWTQKPTSMLPPLQTMKANQNSEWE
EAYINSGRTGWFGAFVVMIGLGIIYGLVLY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96A59	0.163	0.079	8.409E-1	401	0.180	0.067	Q96A59.pdb.gz	MALD3_HUMAN MARVEL domain-containing protein 3 OS=Homo sapiens OX=9606 GN=MARVELD3 PE=2 SV=3
2	AFDB:E7F6S5	0.289	0.253	2.137	177	0.173	0.147	E7F6S5.pdb.gz
3	AFDB:Q96J65	0.145	0.033	2.257	1359	0.200	0.022	Q96J65.pdb.gz	MRP9_HUMAN ATP-binding cassette sub-family C member 12 OS=Homo sapiens OX=9606 GN=ABCC12 PE=1 SV=2
4	AFDB:Q9VU14	0.232	0.071	2.257	835	0.153	0.028	Q9VU14.pdb.gz	Q9VU14_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=Atg1 PE=2 SV=1
5	AFDB:Q5HZK2	0.217	0.166	2.661	202	0.100	0.074	Q5HZK2.pdb.gz	NRSN2_MOUSE Neurensin-2 OS=Mus musculus OX=10090 GN=Nrsn2 PE=1 SV=1
6	AFDB:Q6P5S7	0.164	0.176	2.969	137	0.140	0.153	Q6P5S7.pdb.gz	RNK_HUMAN Ribonuclease kappa OS=Homo sapiens OX=9606 GN=RNASEK PE=1 SV=2
7	PDB:5yx9A	0.233	0.071	3.662	675	0.067	0.015	5yx9A.pdb.gz
8	AFDB:Q5U127	0.132	0.049	3.698	792	0.140	0.027	Q5U127.pdb.gz	Q5U127_DROME Decapping protein 2, isoform E OS=Drosophila melanogaster OX=7227 GN=DCP2 PE=2 SV=1
9	PDB:5mdxa	0.138	0.086	4.087	330	0.060	0.027	5mdxa.pdb.gz	Subunit and chlorophyll organization of the plant photosystem II supercomplex.
10	AFDB:O75385	0.237	0.056	4.605	1050	0.153	0.022	O75385.pdb.gz	ULK1_HUMAN Serine/threonine-protein kinase ULK1 OS=Homo sapiens OX=9606 GN=ULK1 PE=1 SV=2
11	AFDB:P56720	0.219	0.043	4.605	1134	0.167	0.022	P56720.pdb.gz	SRBP1_RAT Sterol regulatory element-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Srebf1 PE=1 SV=3
12	AFDB:Q2MHH0	0.276	0.245	4.605	173	0.133	0.116	Q2MHH0.pdb.gz	TARG1_RAT Trafficking regulator of GLUT4 1 OS=Rattus norvegicus OX=10116 GN=Trarg1 PE=1 SV=1
13	PDB:7n8oA	0.153	0.097	5.089	334	0.107	0.048	7n8oA.pdb.gz	High-resolution cryo-electron microscopy structure of photosystem II from the mesophilic cyanobacterium, Synechocystis sp. PCC 6803.
14	PDB:4jrzA	0.131	0.127	5.679	155	0.093	0.090	4jrzA.pdb.gz	Crystal Structures of Leukotriene C4 Synthase in Complex with Product Analogs: IMPLICATIONS FOR THE ENZYME MECHANISM.
15	PDB:7vvuV	0.201	0.264	5.999	113	0.073	0.097	7vvuV.pdb.gz	Structure of the NuA4 acetyltransferase complex bound to the nucleosome.
16	PDB:2c1wB	0.101	0.066	6.695	276	0.053	0.029	2c1wB.pdb.gz	The Structure of the Endoribonuclease Xendou: From Small Nucleolar RNA Processing to Severe Acute Respiratory Syndrome Coronavirus Replication.
17	PDB:7e1vM	0.189	0.091	7.073	378	0.087	0.034	7e1vM.pdb.gz	Structure of Mycobacterium tuberculosis cytochrome bcc in complex with Q203 and TB47, two anti-TB drug candidates.
18	PDB:2a79B	0.188	0.126	7.471	259	0.087	0.050	2a79B.pdb.gz	Crystal structure of a mammalian voltage-dependent Shaker family K+ channel.
19	PDB:4ntaA	0.146	0.149	7.471	147	0.113	0.116	4ntaA.pdb.gz
20	PDB:6uiwA	0.212	0.127	8.338	294	0.073	0.037	6uiwA.pdb.gz	The structures and gating mechanism of human calcium homeostasis modulator 2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8CES1	3.54e-23	89.0	96	0.320	0.500	PMIS2_MOUSE Transmembrane protein PMIS2 OS=Mus musculus OX=10090 GN=Pmis2 PE=2 SV=2
2	C6KT15	1.06e-04	43.5	2394	0.153	0.010	C6KT15_PLAF7 Erythrocyte membrane protein 1, PfEMP1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0617400 PE=4 SV=1
3	Q8JSZ3	0.003	38.9	1684	0.173	0.015	GP_CCHFI Envelopment polyprotein OS=Crimean-Congo hemorrhagic fever virus (strain Nigeria/IbAr10200/1970) OX=652961 GN=GP PE=1 SV=1
4	A0A8I6ARN7	0.004	38.9	1579	0.147	0.014	A0A8I6ARN7_RAT SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 OS=Rattus norvegicus OX=10116 GN=Smarca2 PE=1 SV=1
5	E9PTG1	0.004	38.9	1597	0.147	0.014	E9PTG1_RAT SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 OS=Rattus norvegicus OX=10116 GN=Smarca2 PE=1 SV=1
6	O97267	0.004	38.9	2114	0.160	0.011	O97267_PLAF7 Circumsporozoite- and TRAP-related protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0315200 PE=4 SV=1
7	Q6DUH4	0.005	38.5	1597	0.147	0.014	Q6DUH4_RAT SWI/SNF-related matrix-associated actin-dependent regulator of chromatin a2 OS=Rattus norvegicus OX=10116 GN=Smarca2 PE=2 SV=1
8	A0A0G2JUS4	0.006	38.1	1488	0.147	0.015	A0A0G2JUS4_RAT SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 OS=Rattus norvegicus OX=10116 GN=Smarca2 PE=1 SV=2
9	O08774	0.022	36.6	1387	0.093	0.010	RGS12_RAT Regulator of G-protein signaling 12 OS=Rattus norvegicus OX=10116 GN=Rgs12 PE=1 SV=1
10	Q6DIC0	0.027	36.6	1577	0.147	0.014	SMCA2_MOUSE Probable global transcription activator SNF2L2 OS=Mus musculus OX=10090 GN=Smarca2 PE=1 SV=1
11	Q58DZ9	0.043	35.4	258	0.153	0.089	SYNG1_RAT Synapse differentiation-inducing gene protein 1 OS=Rattus norvegicus OX=10116 GN=Syndig1 PE=1 SV=1
12	A2ANU3	0.044	35.4	258	0.153	0.089	SYNG1_MOUSE Synapse differentiation-inducing gene protein 1 OS=Mus musculus OX=10090 GN=Syndig1 PE=1 SV=1
13	Q6P122	0.090	34.7	856	0.153	0.027	Q6P122_DANRE dynamin GTPase OS=Danio rerio OX=7955 GN=dnm2l PE=1 SV=1
14	Q9H7V2	0.11	34.3	258	0.147	0.085	SYNG1_HUMAN Synapse differentiation-inducing gene protein 1 OS=Homo sapiens OX=9606 GN=SYNDIG1 PE=1 SV=1
15	Q8CGE9	0.14	34.3	1381	0.093	0.010	RGS12_MOUSE Regulator of G-protein signaling 12 OS=Mus musculus OX=10090 GN=Rgs12 PE=1 SV=2
16	Q08877	0.19	33.9	869	0.127	0.022	DYN3_RAT Dynamin-3 OS=Rattus norvegicus OX=10116 GN=Dnm3 PE=1 SV=2
17	A2A122	0.20	33.9	791	0.120	0.023	A2A122_DANRE Doublecortin like protein kinase_2 OS=Danio rerio OX=7955 GN=cb572 PE=1 SV=1
18	A2A121	0.25	33.5	810	0.120	0.022	A2A121_DANRE Doublecortin like protein kinase_1 OS=Danio rerio OX=7955 GN=cb572 PE=1 SV=1
19	A6NHB5	0.38	33.1	1372	0.140	0.015	A6NHB5_HUMAN Zinc finger MYM-type containing 3 OS=Homo sapiens OX=9606 GN=ZMYM3 PE=1 SV=1
20	A6NHN7	0.47	32.7	1280	0.140	0.016	A6NHN7_HUMAN Zinc finger MYM-type containing 3 OS=Homo sapiens OX=9606 GN=ZMYM3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04505 CD225	3.2e-05	35.3	Interferon-induced transmembrane protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 879308.HMPREF9130_1039

Rank	PPI partner	STRING score	Description
1	879308.HMPREF9130_1187	0.988	annotation not available
2	879308.HMPREF9130_0864	0.937	annotation not available
3	879308.HMPREF9130_1467	0.894	annotation not available
4	879308.HMPREF9130_2192	0.874	annotation not available
5	879308.HMPREF9130_1581	0.852	Essential cell division protein.
6	879308.HMPREF9130_1146	0.828	annotation not available
7	879308.HMPREF9130_1753	0.791	annotation not available
8	879308.HMPREF9130_2219	0.782	annotation not available
9	879308.HMPREF9130_0968	0.776	annotation not available
10	879308.HMPREF9130_0097	0.756	annotation not available
11	879308.HMPREF9130_2222	0.756	Uncharacterized protein
12	879308.HMPREF9130_0038	0.754	Belongs to the peptidase S11 family.
13	879308.HMPREF9130_1582	0.716	Essential cell division protein that forms a contractile ring structure (Z ring) at the future cell division site. The regulation of the ring assembly controls the timing and the location of cell division. One of the functions of the FtsZ ring is to recruit other cell division proteins to the septum to produce a new cell wall between the dividing cells. Binds GTP and shows GTPase activity.
14	879308.HMPREF9130_0662	0.713	DNA-directed DNA polymerase
15	879308.HMPREF9130_0354	0.710	annotation not available
16	879308.HMPREF9130_0518	0.700	Confers DNA tethering and processivity to DNA polymerases and other proteins. Acts as a clamp, forming a ring around DNA (a reaction catalyzed by the clamp-loading complex) which diffuses in an ATP- independent manner freely and bidirectionally along dsDNA. Initially characterized for its ability to contact the catalytic subunit of DNA polymerase III (Pol III), a complex, multichain enzyme responsible for most of the replicative synthesis in bacteria
17	879308.HMPREF9130_0019	0.698	Belongs to the 5'-nucleotidase family.
18	879308.HMPREF9130_0782	0.690	annotation not available
19	879308.HMPREF9130_0144	0.679	annotation not available
20	879308.HMPREF9130_0134	0.668	annotation not available

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.627	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0005622	0.986	intracellular anatomical structure
GO:0005737	0.968	cytoplasm
GO:0016020	0.910	membrane
GO:0043229	0.658	intracellular organelle
GO:0043231	0.652	intracellular membrane-bounded organelle
GO:0012505	0.615	endomembrane system
GO:0071944	0.546	cell periphery
GO:0005886	0.330	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]