StarFunc result for job id A0A286YF58

User Input

>input (385 residues)
MKWSVRGACAALSSCLLLACALSAAAVGLKCFSLGSELRGEPFRLGAAAGAFYSGLLLAA
GLSLLGAALLCCGPRDAPLAGSEPGPGLGVPAAPAGAPEATPGESGAAAGAPGPVSSQNL
LLLGVLVFMLGVLSAFAGAVIDGDTVSLVERKYSHYCLPPRAPGSSPGSAPGSTPGSAPG
SAPGSAPGSAPGAPRARSTLDSATSAKCRQLKDYQRGLVLSTVFNSLECLLGLLSLLLVK
NYKSSQARRGRRGRRRGGRALARPRGGSGLRAQPPASRARRGRRGRRGRRLQQRPSEASI
LSPEESDLAAPGDCAGFAAHHAVSYINVGVLHALDEAGAEVRCGGHPSVELPGYAPSDPD
LNASYPYCCRPPCETPRPWETHRAC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5VTL8	0.164	0.121	1.210E-1	546	0.119	0.084	Q5VTL8.pdb.gz	PR38B_HUMAN Pre-mRNA-splicing factor 38B OS=Homo sapiens OX=9606 GN=PRPF38B PE=1 SV=1
2	AFDB:F1SK18	0.103	0.075	1.548E-1	574	0.190	0.127	F1SK18.pdb.gz	F1SK18_PIG Perilipin 1 OS=Sus scrofa OX=9823 GN=PLIN1 PE=1 SV=4
3	AFDB:E1B9V6	0.129	0.072	1.750E-1	783	0.208	0.102	E1B9V6.pdb.gz	E1B9V6_BOVIN Rabenosyn, RAB effector OS=Bos taurus OX=9913 GN=RBSN PE=1 SV=1
4	AFDB:Q8IDY5	0.220	0.195	1.861E-1	459	0.055	0.046	Q8IDY5.pdb.gz	Q8IDY5_PLAF7 MSP7-like protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1334300 PE=4 SV=1
5	AFDB:Q388M7	0.074	0.075	2.105E-1	377	0.166	0.170	Q388M7.pdb.gz	Q388M7_TRYB2 RNA-binding protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.3200 PE=4 SV=1
6	AFDB:Q53KK6	0.108	0.064	2.105E-1	784	0.140	0.069	Q53KK6.pdb.gz	SWI3C_ORYSJ SWI/SNF complex subunit SWI3C homolog OS=Oryza sativa subsp. japonica OX=39947 GN=SWI3C PE=1 SV=1
7	AFDB:Q9H1K0	0.144	0.082	2.105E-1	784	0.153	0.075	Q9H1K0.pdb.gz	RBNS5_HUMAN Rabenosyn-5 OS=Homo sapiens OX=9606 GN=RBSN PE=1 SV=2
8	AFDB:E7EV93	0.112	0.064	2.532E-1	749	0.127	0.065	E7EV93.pdb.gz	E7EV93_HUMAN Pericentriolar material 1 (Fragment) OS=Homo sapiens OX=9606 GN=PCM1 PE=1 SV=1
9	AFDB:Q384Z4	0.157	0.119	2.532E-1	544	0.122	0.086	Q384Z4.pdb.gz	Q384Z4_TRYB2 Leucine-rich repeat protein (LRRP) OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.4590 PE=4 SV=1
10	AFDB:Q38CL4	0.162	0.169	2.532E-1	366	0.156	0.164	Q38CL4.pdb.gz	Q38CL4_TRYB2 Peroxisomal membrane protein PEX14 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.100.0130 PE=3 SV=1
11	PDB:7sqkE	0.133	0.090	2.668	610	0.119	0.075	7sqkE.pdb.gz
12	PDB:6vgcD	0.128	0.244	3.860	155	0.062	0.155	6vgcD.pdb.gz	Structure-based, multi-targeted drug discovery approach to eicosanoid inhibition: Dual inhibitors of mPGES-1 and 5-lipoxygenase activating protein (FLAP).
13	PDB:7rhsA	0.087	0.074	4.365	456	0.036	0.031	7rhsA.pdb.gz
14	PDB:3iwkH	0.095	0.076	4.643	497	0.029	0.022	3iwkH.pdb.gz	Structural and functional characterization of plant aminoaldehyde dehydrogenase from Pisum sativum with a broad specificity for natural and synthetic aminoaldehydes.
15	PDB:1h2sA	0.089	0.128	5.939	225	0.029	0.049	1h2sA.pdb.gz	Molecular Basis of Transmembrane Signalling by Sensory Rhodopsin II-Transducer Complex
16	PDB:7finR	0.163	0.165	6.717	380	0.068	0.068	7finR.pdb.gz	Structural insights into multiplexed pharmacological actions of tirzepatide and peptide 20 at the GIP, GLP-1 or glucagon receptors.
17	PDB:6pvpA	0.133	0.086	7.143	661	0.044	0.026	6pvpA.pdb.gz
18	PDB:7dvqR	0.086	0.131	7.596	241	0.083	0.133	7dvqR.pdb.gz	Structure of the activated human minor spliceosome.
19	PDB:7vqxR	0.188	0.198	9.137	361	0.060	0.064	7vqxR.pdb.gz	A distinctive ligand recognition mechanism by the human vasoactive intestinal polypeptide receptor 2.
20	PDB:7bw0R	0.085	0.110	9.717	280	0.060	0.082	7bw0R.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O97267	0.001	43.5	2114	0.055	0.010	O97267_PLAF7 Circumsporozoite- and TRAP-related protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0315200 PE=4 SV=1
2	A0A0B4LGM0	0.074	37.7	1173	0.081	0.026	A0A0B4LGM0_DROME Prominin, isoform E OS=Drosophila melanogaster OX=7227 GN=prom PE=1 SV=1
3	B7YZQ3	0.10	37.4	1235	0.081	0.025	B7YZQ3_DROME Prominin, isoform D OS=Drosophila melanogaster OX=7227 GN=prom PE=1 SV=1
4	Q5F8W9	0.13	37.0	756	0.042	0.021	Q5F8W9_NEIG1 site-specific DNA-methyltransferase (adenine-specific) OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) OX=242231 GN=NGO_0641 PE=3 SV=1
5	Q6PAR5	0.14	37.0	1458	0.088	0.023	GAPD1_MOUSE GTPase-activating protein and VPS9 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Gapvd1 PE=1 SV=2
6	A8TX70	0.17	36.6	2615	0.109	0.016	CO6A5_HUMAN Collagen alpha-5(VI) chain OS=Homo sapiens OX=9606 GN=COL6A5 PE=1 SV=1
7	F8W9S7	0.18	36.6	1412	0.088	0.024	F8W9S7_HUMAN GTPase activating protein and VPS9 domains 1 OS=Homo sapiens OX=9606 GN=GAPVD1 PE=1 SV=1
8	Q14C86	0.19	36.6	1478	0.088	0.023	GAPD1_HUMAN GTPase-activating protein and VPS9 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=GAPVD1 PE=1 SV=2
9	C9IZ08	0.29	35.8	988	0.088	0.034	C9IZ08_HUMAN GTPase activating protein and VPS9 domains 1 (Fragment) OS=Homo sapiens OX=9606 GN=GAPVD1 PE=1 SV=1
10	H0Y7I9	0.34	35.4	837	0.088	0.041	H0Y7I9_HUMAN GTPase activating protein and VPS9 domains 1 (Fragment) OS=Homo sapiens OX=9606 GN=GAPVD1 PE=1 SV=1
11	A3KGF7	0.57	35.0	1181	0.114	0.037	PLCB2_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2 OS=Mus musculus OX=10090 GN=Plcb2 PE=1 SV=1
12	Q06PM6	0.86	34.3	910	0.075	0.032	Q06PM6_DROME Prominin OS=Drosophila melanogaster OX=7227 GN=prom PE=2 SV=1
13	Q8MLN9	0.86	34.3	911	0.075	0.032	Q8MLN9_DROME Prominin, isoform C OS=Drosophila melanogaster OX=7227 GN=prom PE=1 SV=2
14	A0AVW1	1.2	33.9	1066	0.075	0.027	A0AVW1_DROME IP13255p OS=Drosophila melanogaster OX=7227 GN=prom PE=1 SV=1
15	A8JQU6	3.6	32.3	1448	0.060	0.016	A8JQU6_DROME Alhambra, isoform J OS=Drosophila melanogaster OX=7227 GN=Alh PE=4 SV=2
16	Q86BS0	3.6	32.3	1473	0.039	0.010	Q86BS0_DROME RIM-binding protein, isoform O OS=Drosophila melanogaster OX=7227 GN=Rbp PE=1 SV=3
17	Q86BP0	3.9	32.3	1487	0.039	0.010	Q86BP0_DROME RIM-binding protein, isoform L OS=Drosophila melanogaster OX=7227 GN=Rbp PE=1 SV=3
18	A0A0B4JCX2	4.3	32.0	1817	0.039	0.008	A0A0B4JCX2_DROME RIM-binding protein, isoform G OS=Drosophila melanogaster OX=7227 GN=Rbp PE=1 SV=1
19	A0A0B4JDC9	4.4	32.0	1844	0.039	0.008	A0A0B4JDC9_DROME RIM-binding protein, isoform F OS=Drosophila melanogaster OX=7227 GN=Rbp PE=1 SV=1
20	Q9VF66	4.4	32.0	1748	0.039	0.009	Q9VF66_DROME RIM-binding protein, isoform K OS=Drosophila melanogaster OX=7227 GN=Rbp PE=1 SV=5

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1408254.T458_12275

Rank	PPI partner	STRING score	Description
1	1408254.T458_07450	0.985	Uncharacterized protein
2	1408254.T458_23680	0.982	Belongs to the peptidase S8 family.
3	1408254.T458_07720	0.981	Phage-associated protein
4	1408254.T458_05885	0.973	S-layer protein
5	1408254.T458_17810	0.968	Cell division protein that may be involved in stabilizing or promoting the assembly of the division complex
6	1408254.T458_23605	0.956	Diguanylate cyclase
7	1408254.T458_05585	0.944	Metalloendopeptidase
8	1408254.T458_16075	0.944	Metalloendopeptidase
9	1408254.T458_05910	0.943	Uncharacterized protein
10	1408254.T458_19595	0.942	Negative regulator of septation ring formation
11	1408254.T458_05905	0.932	Middle cell wall protein
12	1408254.T458_20070	0.922	Endoglucanase
13	1408254.T458_20980	0.921	Uncharacterized protein
14	1408254.T458_17890	0.919	S-layer protein
15	1408254.T458_19085	0.919	Lysophospholipase
16	1408254.T458_03745	0.918	DNA polymerase III subunit delta
17	1408254.T458_19685	0.915	Uncharacterized protein
18	1408254.T458_26945	0.913	Beta-hexosaminidase
19	1408254.T458_06485	0.907	Part of the Sec protein translocase complex. Interacts with the SecYEG preprotein conducting channel. Has a central role in coupling the hydrolysis of ATP to the transfer of proteins into and across the cell membrane, serving as an ATP-driven molecular motor driving the stepwise translocation of polypeptide chains across the membrane
20	1408254.T458_01475	0.902	3'-5' exonuclease

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.453	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.999	cellular anatomical entity
GO:0071944	0.702	cell periphery
GO:0016020	0.684	membrane
GO:0005622	0.589	intracellular anatomical structure
GO:0005886	0.316	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]