StarFunc result for job id A0A2R8Y7Y5

User Input

>input (234 residues)
MACPQLPPLLLLVLVVLLKAGVNYNTPFTDIVTSENSMETSPVSSLISSPFAHSTHSSGE
PPKSYSSTMSLETDSITHLSPSSSGATPTIQPSPSSTDSRMIPSSPQPETITHPSSGSPS
AELTPSSHSTLPSSESLTPHWSPTSHSPGTEPLTSTDQTLEPPGPAPGDTGPRELHRNPS
VVVVVCLLVSLLLIGSVVMAVRFCHRNESKFENLDEVSMGSVNDRLSFAHHLQE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q4W5J1	0.171	0.156	1.964E-1	261	0.184	0.165	Q4W5J1.pdb.gz	Q4W5J1_HUMAN Endomucin, isoform CRA_a OS=Homo sapiens OX=9606 GN=EMCN PE=2 SV=1
2	AFDB:B3DJL5	0.141	0.049	4.125E-1	835	0.205	0.057	B3DJL5.pdb.gz
3	AFDB:F4I924	0.173	0.159	5.155E-1	263	0.154	0.137	F4I924.pdb.gz	F4I924_ARATH Transmembrane protein OS=Arabidopsis thaliana OX=3702 GN=ATI3A PE=1 SV=1
4	AFDB:B2XY77	0.149	0.074	6.441E-1	599	0.128	0.050	B2XY77.pdb.gz
5	AFDB:Q6GMG1	0.104	0.043	7.472E-1	638	0.171	0.063	Q6GMG1.pdb.gz
6	AFDB:Q8VD58	0.209	0.127	9.336E-1	444	0.175	0.092	Q8VD58.pdb.gz	EVI2B_MOUSE Protein EVI2B OS=Mus musculus OX=10090 GN=Evi2b PE=1 SV=1
7	AFDB:G4WJE8	0.193	0.167	1.006	284	0.184	0.151	G4WJE8.pdb.gz	G4WJE8_DANRE P-selectin glycoprotein ligand 1 precursor OS=Danio rerio OX=7955 GN=selplg PE=2 SV=1
8	AFDB:O95259	0.138	0.049	1.256	989	0.154	0.036	O95259.pdb.gz	KCNH1_HUMAN Potassium voltage-gated channel subfamily H member 1 OS=Homo sapiens OX=9606 GN=KCNH1 PE=1 SV=1
9	AFDB:Q9R0H2	0.173	0.158	1.353	261	0.231	0.207	Q9R0H2.pdb.gz	MUCEN_MOUSE Endomucin OS=Mus musculus OX=10090 GN=Emcn PE=1 SV=1
10	AFDB:Q53QW1	0.133	0.092	1.458	395	0.188	0.111	Q53QW1.pdb.gz	TEX44_HUMAN Testis-expressed protein 44 OS=Homo sapiens OX=9606 GN=TEX44 PE=1 SV=1
11	PDB:7aavv	0.133	0.146	6.561	206	0.060	0.068	7aavv.pdb.gz	Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.
12	PDB:7b93Z	0.172	0.250	7.066	143	0.060	0.098	7b93Z.pdb.gz	Cork-in-bottle mechanism of inhibitor binding to mammalian complex I.
13	PDB:7mqaSI	0.130	0.053	8.197	803	0.098	0.029	7mqaSI.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:5xtdW	0.169	0.255	8.829	138	0.056	0.094	5xtdW.pdb.gz	Architecture of Human Mitochondrial Respiratory Megacomplex I2III2IV2.
15	PDB:7d5sRN	0.145	0.063	8.829	607	0.056	0.021	7d5sRN.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
16	PDB:7mq9SI	0.145	0.052	8.829	844	0.081	0.023	7mq9SI.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	PDB:6yxxET	0.080	0.163	9.509	101	0.034	0.079	6yxxET.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B7YZG4	5.75e-04	43.1	5368	0.171	0.007	B7YZG4_DROME Short stop, isoform J OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
2	A0A0B4K7P8	5.96e-04	43.1	5394	0.171	0.007	A0A0B4K7P8_DROME Short stop, isoform Z OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
3	A1Z9I9	6.76e-04	43.1	5390	0.154	0.007	A1Z9I9_DROME Short stop, isoform B OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
4	E1JH62	6.76e-04	43.1	5388	0.154	0.007	E1JH62_DROME Short stop, isoform N OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
5	B7YZG3	7.53e-04	42.7	5375	0.154	0.007	B7YZG3_DROME Short stop, isoform I OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
6	A0A0B4K7Y9	7.54e-04	42.7	5408	0.154	0.007	A0A0B4K7Y9_DROME Short stop, isoform AA OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
7	Q7KJN8	8.47e-04	42.7	5201	0.154	0.007	Q7KJN8_DROME Short stop/Kakapo long isoform OS=Drosophila melanogaster OX=7227 GN=shot PE=2 SV=1
8	B7YZG6	8.48e-04	42.7	5479	0.154	0.007	B7YZG6_DROME Short stop, isoform M OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
9	E1JH63	8.48e-04	42.7	5499	0.154	0.007	E1JH63_DROME Short stop, isoform O OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
10	A1Z9J0	8.94e-04	42.7	5201	0.154	0.007	A1Z9J0_DROME Short stop, isoform E OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
11	A1Z9J1	8.95e-04	42.7	5501	0.154	0.007	A1Z9J1_DROME Short stop, isoform A OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
12	B7YZG5	8.95e-04	42.7	5486	0.154	0.007	B7YZG5_DROME Short stop, isoform L OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
13	A0A0B4K718	0.001	42.7	4100	0.154	0.009	A0A0B4K718_DROME Short stop, isoform AB OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
14	A0A0B4K788	0.001	42.4	5462	0.154	0.007	A0A0B4K788_DROME Short stop, isoform AC OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
15	A0A0B4K867	0.001	42.4	5463	0.154	0.007	A0A0B4K867_DROME Short stop, isoform Y OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
16	A0A0B4K869	0.001	42.4	5434	0.154	0.007	A0A0B4K869_DROME Short stop, isoform AD OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
17	A1Z9J2	0.001	42.4	5160	0.154	0.007	A1Z9J2_DROME Short stop, isoform C OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
18	E1JH65	0.001	42.4	5458	0.154	0.007	E1JH65_DROME Short stop, isoform P OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
19	A1Z9J3	0.004	40.4	8805	0.154	0.004	A1Z9J3_DROME Short stop, isoform H OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
20	O77375	0.004	40.4	2457	0.197	0.019	O77375_PLAF7 DNA-directed RNA polymerase subunit OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0318200 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08999 SP_C-Propep	32	15.7	Surfactant protein C, N terminal propeptide

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008969288.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008969286.1	0.541	Uncharacterized protein KIAA1683 homolog isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.704	cellular process
GO:0050789	0.572	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	0.995	intracellular organelle
GO:0005737	0.990	cytoplasm
GO:0043231	0.985	intracellular membrane-bounded organelle
GO:0005634	0.926	nucleus
GO:0016020	0.910	membrane
GO:0071944	0.797	cell periphery
GO:0005886	0.784	plasma membrane
GO:0009897	0.405	external side of plasma membrane
GO:0005794	0.389	Golgi apparatus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]